StarFunc result for job id Q5XKE5

User Input

>input (535 residues)
MRSSVSRQTYSTKGGFSSNSASGGSGSQARTSFSSVTVSRSSGSGGGAHCGPGTGGFGSR
SLYNLGGHKSISVSVAGGALLGRALGGFGFGSRAFMGQGAGRQTFGPACPPGGIQEVTVN
QSLLTPLHVEIDPEIQRVRTQEREQIKTLNNKFASFIDKVRFLEQQNKVLETKWALLQEQ
GQNLGVTRNNLEPLFEAYLGSMRSTLDRLQSERGRLDSELRNVQDLVEDFKNKYEDEINK
HTAAENEFVVLKKDVDAAYMGRMDLHGKVGTLTQEIDFLQQLYEMELSQVQTHVSNTNVV
LSMDNNRNLDLDSIIAEVKAQYELIAQRSRAEAEAWYQTKYEELQVTAGKHGDNLRDTKN
EIAELTRTIQRLQGEADAAKKQCQQLQTAIAEAEQRGELALKDAQKKLGDLDVALHQAKE
DLTRLLRDYQELMNVKLALDVEIATYRKLLESEESRMSGECPSAVSISVTGNSTTVCGGG
AASFGGGISLGGSGGATKGGFSTNVGYSTVKGGPVSAGTSILRKTTTVKTSSQRY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5XKE5	1.000	1.000	1.043E-67	535	1.000	1.000	Q5XKE5.pdb.gz	K2C79_HUMAN Keratin, type II cytoskeletal 79 OS=Homo sapiens OX=9606 GN=KRT79 PE=1 SV=2
2	AFDB:O95678	0.315	0.307	2.036E-37	551	0.619	0.601	O95678.pdb.gz	K2C75_HUMAN Keratin, type II cytoskeletal 75 OS=Homo sapiens OX=9606 GN=KRT75 PE=1 SV=2
3	AFDB:Q8BGZ7	0.376	0.367	2.036E-37	551	0.622	0.604	Q8BGZ7.pdb.gz	K2C75_MOUSE Keratin, type II cytoskeletal 75 OS=Mus musculus OX=10090 GN=Krt75 PE=1 SV=1
4	AFDB:P02538	0.322	0.308	1.099E-36	564	0.664	0.629	P02538.pdb.gz	K2C6A_HUMAN Keratin, type II cytoskeletal 6A OS=Homo sapiens OX=9606 GN=KRT6A PE=1 SV=3
5	AFDB:A0A1D5PXP0	0.378	0.385	1.383E-36	522	0.576	0.590	A0A1D5PXP0.pdb.gz
6	AFDB:Q9Z331	0.321	0.307	2.757E-36	562	0.621	0.591	Q9Z331.pdb.gz	K2C6B_MOUSE Keratin, type II cytoskeletal 6B OS=Mus musculus OX=10090 GN=Krt6b PE=1 SV=3
7	AFDB:P19013	0.401	0.408	4.045E-36	520	0.617	0.635	P19013.pdb.gz	K2C4_HUMAN Keratin, type II cytoskeletal 4 OS=Homo sapiens OX=9606 GN=KRT4 PE=1 SV=5
8	AFDB:P13647	0.318	0.291	8.705E-36	590	0.630	0.571	P13647.pdb.gz	K2C5_HUMAN Keratin, type II cytoskeletal 5 OS=Homo sapiens OX=9606 GN=KRT5 PE=1 SV=3
9	AFDB:Q922U2	0.405	0.377	1.015E-35	580	0.628	0.579	Q922U2.pdb.gz	K2C5_MOUSE Keratin, type II cytoskeletal 5 OS=Mus musculus OX=10090 GN=Krt5 PE=1 SV=1
10	AFDB:Q6PVZ5	0.406	0.369	1.735E-35	599	0.647	0.578	Q6PVZ5.pdb.gz	Q6PVZ5_CHICK Type II alpha-keratin IIA OS=Gallus gallus OX=9031 GN=KRT5 PE=2 SV=1
11	PDB:7aavv	0.082	0.203	5.515	206	0.015	0.039	7aavv.pdb.gz	Mechanism of protein-guided folding of the active site U2/U6 RNA during spliceosome activation.
12	PDB:8at3A	0.147	0.247	6.429	286	0.080	0.150	8at3A.pdb.gz
13	PDB:5lj5O	0.104	0.170	7.494	283	0.039	0.074	5lj5O.pdb.gz	Cryo-EM structure of the spliceosome immediately after branching.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	O95678	605	551	0.585	0.568	K2C75_HUMAN Keratin, type II cytoskeletal 75 OS=Homo sapiens OX=9606 GN=KRT75 PE=1 SV=2
2	P02538	572	564	0.561	0.532	K2C6A_HUMAN Keratin, type II cytoskeletal 6A OS=Homo sapiens OX=9606 GN=KRT6A PE=1 SV=3
3	P04259	579	564	0.607	0.576	K2C6B_HUMAN Keratin, type II cytoskeletal 6B OS=Homo sapiens OX=9606 GN=KRT6B PE=1 SV=5
4	P07744	555	525	0.559	0.570	K2C4_MOUSE Keratin, type II cytoskeletal 4 OS=Mus musculus OX=10090 GN=Krt4 PE=1 SV=2
5	P12035	524	628	0.482	0.411	K2C3_HUMAN Keratin, type II cytoskeletal 3 OS=Homo sapiens OX=9606 GN=KRT3 PE=1 SV=3
6	P13647	583	590	0.587	0.532	K2C5_HUMAN Keratin, type II cytoskeletal 5 OS=Homo sapiens OX=9606 GN=KRT5 PE=1 SV=3
7	P19013	577	520	0.564	0.581	K2C4_HUMAN Keratin, type II cytoskeletal 4 OS=Homo sapiens OX=9606 GN=KRT4 PE=1 SV=5
8	P48668	579	564	0.607	0.576	K2C6C_HUMAN Keratin, type II cytoskeletal 6C OS=Homo sapiens OX=9606 GN=KRT6C PE=1 SV=3
9	P50446	577	553	0.566	0.548	K2C6A_MOUSE Keratin, type II cytoskeletal 6A OS=Mus musculus OX=10090 GN=Krt6a PE=1 SV=3
10	Q0IIN1	535	578	0.508	0.471	Q0IIN1_HUMAN Keratin 77 OS=Homo sapiens OX=9606 GN=KRT77 PE=1 SV=1
11	Q14CN4	523	511	0.505	0.528	K2C72_HUMAN Keratin, type II cytoskeletal 72 OS=Homo sapiens OX=9606 GN=KRT72 PE=1 SV=2
12	Q29426	530	629	0.516	0.439	K2C3_RABIT Keratin, type II cytoskeletal 3 OS=Oryctolagus cuniculus OX=9986 GN=KRT3 PE=2 SV=1
13	Q3SY84	538	523	0.523	0.535	K2C71_HUMAN Keratin, type II cytoskeletal 71 OS=Homo sapiens OX=9606 GN=KRT71 PE=1 SV=3
14	Q3UV17	540	594	0.559	0.503	K22O_MOUSE Keratin, type II cytoskeletal 2 oral OS=Mus musculus OX=10090 GN=Krt76 PE=1 SV=1
15	Q5XKE5	1094	535	1.000	1.000	K2C79_HUMAN Keratin, type II cytoskeletal 79 OS=Homo sapiens OX=9606 GN=KRT79 PE=1 SV=2
16	Q6P6Q2	566	576	0.579	0.538	K2C5_RAT Keratin, type II cytoskeletal 5 OS=Rattus norvegicus OX=10116 GN=Krt5 PE=1 SV=1
17	Q6PVZ5	540	599	0.486	0.434	Q6PVZ5_CHICK Type II alpha-keratin IIA OS=Gallus gallus OX=9031 GN=KRT5 PE=2 SV=1
18	Q7Z794	535	578	0.508	0.471	K2C1B_HUMAN Keratin, type II cytoskeletal 1b OS=Homo sapiens OX=9606 GN=KRT77 PE=1 SV=3
19	Q86Y46	546	540	0.548	0.543	K2C73_HUMAN Keratin, type II cytoskeletal 73 OS=Homo sapiens OX=9606 GN=KRT73 PE=1 SV=1
20	Q8BGZ7	577	551	0.568	0.552	K2C75_MOUSE Keratin, type II cytoskeletal 75 OS=Mus musculus OX=10090 GN=Krt75 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13166 AAA_13	5.9e+02	10.5	AAA domain
2	PF11559 ADIP	6.6e+02	11.8	Afadin- and alpha -actinin-Binding
3	PF11839 Alanine_zipper	5.9e+02	12.2	Alanine-zipper, major outer membrane lipoprotein
4	PF08614 ATG16	8e+02	11.6	Autophagy protein 16 (ATG16)
5	PF13270 CCDC28	1.8e+02	13.9	Coiled-coil domain-containing protein 28
6	PF10473 CENP-F_leu_zip	54	15.3	Leucine-rich repeats of kinetochore protein Cenp-F/LEK1
7	PF05335 DUF745	4.4e+02	12.0	Protein of unknown function (DUF745)
8	PF06103 DUF948	6.7e+02	12.0	Bacterial protein of unknown function (DUF948)
9	PF20492 ERM_helical	9.4e+02	11.3	Ezrin/radixin/moesin, alpha-helical domain
10	PF00038 Filament	2.9e-103	357.3	Intermediate filament protein
11	PF13851 GAS	91	13.9	Growth-arrest specific micro-tubule binding
12	PF16208 Keratin_2_head	4.2e-27	106.7	Keratin type II head
13	PF14942 Muted	25	16.6	Organelle biogenesis, Muted-like protein
14	PF18595 Nuf2_DHR10-like	30	16.1	Nuf2, DHR10-like domain
15	PF16740 SKA2	1.5e+02	13.5	Spindle and kinetochore-associated protein 2
16	PF09728 Taxilin	13	16.5	Myosin-like coiled-coil protein
17	PF07926 TPR_MLP1_2	0.00024	32.5	TPR/MLP1/MLP2-like protein
18	PF12718 Tropomyosin_1	53	15.4	Tropomyosin like
19	PF06013 WXG100	1.6e+02	14.0	Proteins of 100 residues with WXG

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000328358

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000273261	0.769	Leucine-rich repeats and immunoglobulin-like domains protein 1
2	9606.ENSP00000328327	0.609	Ankyrin repeat and SOCS box protein 7
3	9606.ENSP00000305975	0.535	Keratin-associated protein 1-1
4	9606.ENSP00000252245	0.528	Keratin, type II cytoskeletal 75
5	9606.ENSP00000257974	0.523	Keratin, type II cuticular Hb2
6	9606.ENSP00000307014	0.522	Keratin, type II cytoskeletal 73
7	9606.ENSP00000267119	0.520	Keratin, type II cytoskeletal 71
8	9606.ENSP00000257901	0.517	Keratin, type II cuticular Hb5
9	9606.ENSP00000257951	0.514	Keratin, type II cuticular Hb4
10	9606.ENSP00000307240	0.511	Keratin, type II cytoskeletal 74
11	9606.ENSP00000369349	0.509	Keratin, type II cuticular Hb1
12	9606.ENSP00000293745	0.507	Keratin, type II cytoskeletal 72
13	9606.ENSP00000444533	0.503	Keratin, type II cuticular Hb6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019899	0.850	enzyme binding
GO:0005198	0.678	structural molecule activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.986	cellular process
GO:0045103	0.873	intermediate filament-based process
GO:0032502	0.719	developmental process
GO:0048856	0.611	anatomical structure development
GO:0071840	0.397	cellular component organization or biogenesis
GO:0065007	0.378	biological regulation
GO:0016043	0.350	cellular component organization
GO:0050789	0.349	regulation of biological process
GO:0032501	0.310	multicellular organismal process
GO:0007010	0.308	cytoskeleton organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043226	0.999	organelle
GO:0005829	0.999	cytosol
GO:0005576	0.996	extracellular region
GO:0043229	0.987	intracellular organelle
GO:0070062	0.987	extracellular exosome
GO:0043232	0.961	intracellular non-membrane-bounded organelle
GO:0099512	0.872	supramolecular fiber
GO:0005882	0.846	intermediate filament
GO:0045095	0.799	keratin filament
GO:0043231	0.397	intracellular membrane-bounded organelle
GO:0016020	0.343	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]