StarFunc result for job id Q5XKR4

User Input

>input (325 residues)
MLSHADLLDARLGMKDAAELLGHREAVKCRLGVGGSDPGGHPGDLAPNSDPVEGATLLPG
EDITTVGSTPASLAVSAKDPDKQPGPQGGPNPSQAGQQQGQQKQKRHRTRFTPAQLNELE
RSFAKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKTTNVFRAPGTLLPTPG
LPQFPSAAAAAAAAMGDSLCSFHANDTRWAAAAMPGVSQLPLPPALGRQQAMAQSLSQCS
LAAGPPPNSMGLSNSLAGSNGAGLQSHLYQPAFPGMVPASLPGPSNVSGSPQLCSSPDSS
DVWRGTSIASLRRKALEHTVSMSFT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O09113	0.704	0.704	1.924E-46	325	1.000	1.000	O09113.pdb.gz	OTP_MOUSE Homeobox protein orthopedia OS=Mus musculus OX=10090 GN=Otp PE=2 SV=1
2	AFDB:Q6DGH9	0.301	0.308	1.883E-36	315	0.818	0.844	Q6DGH9.pdb.gz	OTBP_DANRE Homeobox protein orthopedia B OS=Danio rerio OX=7955 GN=otpb PE=1 SV=1
3	AFDB:B3DGA5	0.325	0.319	4.459E-36	332	0.846	0.828	B3DGA5.pdb.gz	B3DGA5_DANRE Homeobox protein orthopedia OS=Danio rerio OX=7955 GN=otpa PE=2 SV=1
4	AFDB:P56672	0.243	0.197	1.667E-13	409	0.351	0.279	P56672.pdb.gz	OTP_DROME Homeobox protein orthopedia OS=Drosophila melanogaster OX=7227 GN=otp PE=2 SV=2
5	AFDB:Q06453	0.251	0.206	4.090E-11	408	0.326	0.260	Q06453.pdb.gz	AL_DROME Homeobox protein aristaless OS=Drosophila melanogaster OX=7227 GN=al PE=1 SV=2
6	AFDB:Q9Y2V3	0.218	0.205	1.441E-10	346	0.311	0.292	Q9Y2V3.pdb.gz	RX_HUMAN Retinal homeobox protein Rx OS=Homo sapiens OX=9606 GN=RAX PE=1 SV=2
7	AFDB:A6YP92	0.253	0.158	2.989E-10	566	0.298	0.171	A6YP92.pdb.gz	ARX_RAT Homeobox protein ARX OS=Rattus norvegicus OX=10116 GN=Arx PE=2 SV=1
8	AFDB:Q1LVQ7	0.239	0.242	8.080E-10	320	0.280	0.284	Q1LVQ7.pdb.gz	ALX1_DANRE ALX homeobox protein 1 OS=Danio rerio OX=7955 GN=alx1 PE=2 SV=1
9	AFDB:Q9PWR3	0.219	0.218	1.126E-9	326	0.262	0.261	Q9PWR3.pdb.gz	PITX2_XENLA Pituitary homeobox 2 OS=Xenopus laevis OX=8355 GN=pitx2 PE=2 SV=1
10	AFDB:O42356	0.261	0.257	1.467E-9	330	0.295	0.291	O42356.pdb.gz	RX1_DANRE Retinal homeobox protein Rx1 OS=Danio rerio OX=7955 GN=rx1 PE=2 SV=2
11	PDB:2hi3A	0.153	0.612	7.063E-3	73	0.062	0.274	2hi3A.pdb.gz
12	PDB:4egcA	0.153	0.092	8.064E-3	539	0.049	0.030	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
13	PDB:7fbyA	0.124	0.238	7.318E-1	153	0.034	0.072	7fbyA.pdb.gz	Crystal Structure of PH0140 from Pyrococcus horikosii OT3
14	PDB:2vbwA	0.095	0.189	1.089	147	0.046	0.102	2vbwA.pdb.gz	Mechanistic Insights from the Crystal Structures of a Feast/Famine Regulatory Protein from Mycobacterium Tuberculosis H37Rv.
15	PDB:1l3lB	0.116	0.158	1.420	233	0.031	0.043	1l3lB.pdb.gz	Structure of a bacterial quorum-sensing transcription factor complexed with pheromone and DNA.
16	PDB:2cg4A	0.119	0.236	1.517	149	0.034	0.074	2cg4A.pdb.gz	Structural Insight Into Gene Transcriptional Regulation and Effector Binding by the Lrp/Asnc Family.
17	PDB:2cjjA	0.149	0.660	1.851	63	0.031	0.159	2cjjA.pdb.gz
18	PDB:2gqqC	0.097	0.179	1.978	157	0.031	0.064	2gqqC.pdb.gz
19	PDB:6id0L	0.156	0.109	1.978	475	0.037	0.025	6id0L.pdb.gz	Structures of the human spliceosomes before and after release of the ligated exon.
20	PDB:5zr6A	0.109	0.157	2.114	214	0.031	0.047	5zr6A.pdb.gz	Crystal structures of manganese-dependent transcriptional repressor MntR (Rv2788) from Mycobacterium tuberculosis in apo and manganese bound forms.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O09113	0.0	657	325	1.000	1.000	OTP_MOUSE Homeobox protein orthopedia OS=Mus musculus OX=10090 GN=Otp PE=2 SV=1
2	Q5XKR4	0.0	657	325	1.000	1.000	OTP_HUMAN Homeobox protein orthopedia OS=Homo sapiens OX=9606 GN=OTP PE=1 SV=1
3	Q6DGH9	5.90e-156	441	315	0.806	0.832	OTBP_DANRE Homeobox protein orthopedia B OS=Danio rerio OX=7955 GN=otpb PE=1 SV=1
4	F6NUE7	4.37e-155	439	319	0.837	0.853	F6NUE7_DANRE Homeobox protein orthopedia isoform X1 OS=Danio rerio OX=7955 GN=otpa PE=4 SV=1
5	B3DGA5	4.48e-151	429	332	0.837	0.819	B3DGA5_DANRE Homeobox protein orthopedia OS=Danio rerio OX=7955 GN=otpa PE=2 SV=1
6	P56672	6.48e-42	152	409	0.262	0.208	OTP_DROME Homeobox protein orthopedia OS=Drosophila melanogaster OX=7227 GN=otp PE=2 SV=2
7	Q1LVQ7	1.25e-27	111	320	0.172	0.175	ALX1_DANRE ALX homeobox protein 1 OS=Danio rerio OX=7955 GN=alx1 PE=2 SV=1
8	Q06453	1.80e-27	112	408	0.160	0.127	AL_DROME Homeobox protein aristaless OS=Drosophila melanogaster OX=7227 GN=al PE=1 SV=2
9	O42115	3.04e-27	112	453	0.209	0.150	ARX_DANRE Aristaless-related homeobox protein OS=Danio rerio OX=7955 GN=arx PE=2 SV=1
10	Q15699	9.16e-27	109	326	0.255	0.255	ALX1_HUMAN ALX homeobox protein 1 OS=Homo sapiens OX=9606 GN=ALX1 PE=1 SV=2
11	V9HWA7	9.16e-27	109	326	0.255	0.255	V9HWA7_HUMAN Cartilage paired-class homeoprotein 1 OS=Homo sapiens OX=9606 GN=HEL23 PE=2 SV=1
12	Q8C8B0	1.26e-26	109	326	0.255	0.255	ALX1_MOUSE ALX homeobox protein 1 OS=Mus musculus OX=10090 GN=Alx1 PE=1 SV=1
13	Q9XZU0	1.41e-26	109	357	0.135	0.123	Q9XZU0_DROME FI01102p OS=Drosophila melanogaster OX=7227 GN=Pph13 PE=2 SV=1
14	Q8T0V5	1.43e-26	109	357	0.135	0.123	Q8T0V5_DROME GH01528p OS=Drosophila melanogaster OX=7227 GN=Pph13 PE=2 SV=1
15	A6YP92	2.34e-26	111	566	0.142	0.081	ARX_RAT Homeobox protein ARX OS=Rattus norvegicus OX=10116 GN=Arx PE=2 SV=1
16	Q96QS3	2.74e-26	111	562	0.142	0.082	ARX_HUMAN Homeobox protein ARX OS=Homo sapiens OX=9606 GN=ARX PE=1 SV=1
17	O35085	3.48e-26	110	564	0.142	0.082	ARX_MOUSE Homeobox protein ARX OS=Mus musculus OX=10090 GN=Arx PE=1 SV=3
18	Q21836	6.75e-26	107	362	0.197	0.177	ARXH_CAEEL Homeobox ARX homolog alr-1 OS=Caenorhabditis elegans OX=6239 GN=alr-1 PE=1 SV=1
19	G5EC89	8.51e-26	105	237	0.138	0.190	CEH17_CAEEL Homeobox protein ceh-17 OS=Caenorhabditis elegans OX=6239 GN=ceh-17 PE=1 SV=1
20	Q5I7G4	9.68e-26	105	284	0.138	0.158	Q5I7G4_DANRE Paired mesoderm homeobox protein 2B OS=Danio rerio OX=7955 GN=phox2b PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05920 Homeobox_KN	19	16.6	Homeobox KN domain
2	PF00046 Homeodomain	7.3e-21	85.1	Homeodomain
3	PF03826 OAR	0.00018	32.4	OAR motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 1026970.XP_008854205.1

Rank	PPI partner	STRING score	Description
1	1026970.XP_008828181.1	0.701	RNA binding protein, fox-1 homolog 1
2	1026970.XP_008831260.1	0.697	Ornithine carbamoyltransferase, mitochondrial
3	1026970.XP_008821158.1	0.651	Single-minded family bHLH transcription factor 1
4	1026970.XP_008825726.1	0.648	Fez family zinc finger protein 2
5	1026970.XP_008847888.1	0.630	RNA binding protein, fox-1 homolog 3
6	1026970.XP_008832773.1	0.609	Tryptophan 5-hydroxylase 2
7	1026970.XP_008835099.1	0.607	Forkhead box B1
8	1026970.XP_008852699.1	0.590	Oxytocin-neurophysin 1 isoform X1
9	1026970.XP_008825551.1	0.584	Solute carrier family 18 member A2
10	1026970.XP_008827312.1	0.568	Serum response factor
11	1026970.XP_008852698.1	0.549	Arginine vasopressin
12	1026970.XP_008851266.1	0.543	Single-minded family bHLH transcription factor 2
13	1026970.XP_008851624.1	0.534	Aryl hydrocarbon receptor nuclear translocator 2 isoform X1
14	1026970.XP_008837834.1	0.510	POU domain, class 3, transcription factor 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0000981	1.000	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:1990837	1.000	sequence-specific double-stranded DNA binding
GO:0005515	0.998	protein binding
GO:0001067	0.995	transcription regulatory region nucleic acid binding
GO:0000977	0.992	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0001228	0.683	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0000987	0.549	cis-regulatory region sequence-specific DNA binding
GO:0000978	0.530	RNA polymerase II cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0007275	0.996	multicellular organism development
GO:0050789	0.988	regulation of biological process
GO:0048731	0.986	system development
GO:0050794	0.984	regulation of cellular process
GO:0009987	0.979	cellular process
GO:0048513	0.967	animal organ development
GO:0007417	0.929	central nervous system development
GO:0030900	0.889	forebrain development
GO:0019222	0.876	regulation of metabolic process
GO:0030154	0.872	cell differentiation
GO:0060255	0.834	regulation of macromolecule metabolic process
GO:0080090	0.816	regulation of primary metabolic process
GO:0031323	0.816	regulation of cellular metabolic process
GO:0048699	0.809	generation of neurons
GO:0051171	0.800	regulation of nitrogen compound metabolic process
GO:0009889	0.782	regulation of biosynthetic process
GO:0051252	0.779	regulation of RNA metabolic process
GO:0010468	0.776	regulation of gene expression
GO:0021953	0.764	central nervous system neuron differentiation
GO:0048519	0.761	negative regulation of biological process
GO:0006357	0.742	regulation of transcription by RNA polymerase II
GO:0021536	0.741	diencephalon development
GO:0021761	0.685	limbic system development
GO:0021879	0.618	forebrain neuron differentiation
GO:0048518	0.530	positive regulation of biological process
GO:0050896	0.495	response to stimulus
GO:0048523	0.493	negative regulation of cellular process
GO:0048522	0.480	positive regulation of cellular process
GO:0009893	0.407	positive regulation of metabolic process
GO:0010604	0.394	positive regulation of macromolecule metabolic process
GO:0031325	0.390	positive regulation of cellular metabolic process
GO:0051173	0.379	positive regulation of nitrogen compound metabolic process
GO:0031328	0.373	positive regulation of cellular biosynthetic process
GO:0010605	0.325	negative regulation of macromolecule metabolic process
GO:0045893	0.325	positive regulation of DNA-templated transcription
GO:0045892	0.303	negative regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0070013	0.992	intracellular organelle lumen
GO:0031981	0.960	nuclear lumen
GO:0005654	0.912	nucleoplasm
GO:0005737	0.312	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]