StarFunc result for job id Q5XLA6

User Input

>input (110 residues)
MADKVLKEKRKQFIRSVGEGTINGLLGELLETRVLSQEEIEIVKCENATVMDKARALLDS
VIRKGAPACQICITYICEEDSHLAGTLGLSAGPTSGNHLTTQDSQIVLPS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5XLA6	1.000	1.000	3.413E-15	110	1.000	1.000	Q5XLA6.pdb.gz	CAR17_HUMAN Putative caspase recruitment domain-containing protein 17P OS=Homo sapiens OX=9606 GN=CARD17P PE=5 SV=1
2	AFDB:P29466	0.835	0.233	1.320E-11	404	0.809	0.220	P29466.pdb.gz	CASP1_HUMAN Caspase-1 OS=Homo sapiens OX=9606 GN=CASP1 PE=1 SV=1
3	AFDB:Q5EG05	0.816	0.462	2.598E-10	197	0.691	0.386	Q5EG05.pdb.gz	CAR16_HUMAN Caspase recruitment domain-containing protein 16 OS=Homo sapiens OX=9606 GN=CARD16 PE=1 SV=1
4	AFDB:P29452	0.846	0.237	1.012E-9	402	0.582	0.159	P29452.pdb.gz	CASP1_MOUSE Caspase-1 OS=Mus musculus OX=10090 GN=Casp1 PE=1 SV=1
5	AFDB:P43527	0.838	0.236	2.335E-9	402	0.573	0.157	P43527.pdb.gz	CASP1_RAT Caspase-1 OS=Rattus norvegicus OX=10116 GN=Casp1 PE=2 SV=1
6	AFDB:P57730	0.803	0.978	1.530E-7	90	0.445	0.544	P57730.pdb.gz	CAR18_HUMAN Caspase recruitment domain-containing protein 18 OS=Homo sapiens OX=9606 GN=CARD18 PE=1 SV=1
7	AFDB:A0A060XPX2	0.805	0.256	3.532E-7	353	0.409	0.127	A0A060XPX2.pdb.gz	A0A060XPX2_ONCMY Caspase-1 OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00039688001 PE=3 SV=1
8	PDB:1dgnA	0.711	0.866	9.092E-5	89	0.418	0.517	1dgnA.pdb.gz
9	AFDB:P58801	0.747	0.164	3.329E-4	539	0.182	0.037	P58801.pdb.gz	RIPK2_MOUSE Receptor-interacting serine/threonine-protein kinase 2 OS=Mus musculus OX=10090 GN=Ripk2 PE=1 SV=1
10	AFDB:A0A0S2Z4Z8	0.708	0.155	5.330E-4	540	0.191	0.039	A0A0S2Z4Z8.pdb.gz	A0A0S2Z4Z8_HUMAN Receptor-interacting serine-threonine kinase 2 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=RIPK2 PE=2 SV=1
11	AFDB:P42573	0.668	0.165	5.917E-4	503	0.191	0.042	P42573.pdb.gz	CED3_CAEEL Cell death protein 3 OS=Caenorhabditis elegans OX=6239 GN=ced-3 PE=1 SV=2
12	PDB:6mksA	0.710	0.858	3.721E-3	90	0.200	0.244	6mksA.pdb.gz
13	PDB:4ikmA	0.717	0.176	2.859E-2	463	0.236	0.056	4ikmA.pdb.gz	The structure of the CARD8 caspase-recruitment domain suggests its association with the FIIND domain and procaspases through adjacent surfaces.
14	PDB:5juyB	0.642	0.065	5.641E-2	1234	0.155	0.014	5juyB.pdb.gz	A near atomic structure of the active human apoptosome.
15	PDB:2kn6A	0.530	0.328	2.853E-1	195	0.191	0.108	2kn6A.pdb.gz
16	PDB:4irlB	0.691	0.175	3.006E-1	463	0.155	0.037	4irlB.pdb.gz	Structure of the caspase-recruitment domain from a zebrafish guanylate-binding protein.
17	PDB:4a2wA	0.575	0.111	3.337E-1	678	0.136	0.022	4a2wA.pdb.gz
18	PDB:6ki0A	0.561	0.148	3.337E-1	459	0.155	0.037	6ki0A.pdb.gz	Homotypic CARD-CARD interaction is critical for the activation of NLRP1 inflammasome.
19	PDB:6tnnI	0.206	0.174	1.233	134	0.109	0.090	6tnnI.pdb.gz	Structures of B. subtilis Maturation RNases Captured on 50S Ribosome with Pre-rRNAs.
20	PDB:7pntL	0.194	0.139	1.520	176	0.173	0.108	7pntL.pdb.gz	Mechanism of mitoribosomal small subunit biogenesis and preinitiation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5XLA6	5.10e-77	224	110	1.000	1.000	CAR17_HUMAN Putative caspase recruitment domain-containing protein 17P OS=Homo sapiens OX=9606 GN=CARD17P PE=5 SV=1
2	P29466	1.28e-53	174	404	0.809	0.220	CASP1_HUMAN Caspase-1 OS=Homo sapiens OX=9606 GN=CASP1 PE=1 SV=1
3	Q5EG05	1.40e-46	150	197	0.691	0.386	CAR16_HUMAN Caspase recruitment domain-containing protein 16 OS=Homo sapiens OX=9606 GN=CARD16 PE=1 SV=1
4	P29452	2.27e-34	124	402	0.582	0.159	CASP1_MOUSE Caspase-1 OS=Mus musculus OX=10090 GN=Casp1 PE=1 SV=1
5	P43527	1.20e-33	122	402	0.564	0.154	CASP1_RAT Caspase-1 OS=Rattus norvegicus OX=10116 GN=Casp1 PE=2 SV=1
6	P57730	7.75e-26	94.0	90	0.445	0.544	CAR18_HUMAN Caspase recruitment domain-containing protein 18 OS=Homo sapiens OX=9606 GN=CARD18 PE=1 SV=1
7	A0A060XPX2	7.30e-17	76.3	353	0.418	0.130	A0A060XPX2_ONCMY Caspase-1 OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00039688001 PE=3 SV=1
8	Q9NPP4	6.31e-04	39.7	1024	0.191	0.021	NLRC4_HUMAN NLR family CARD domain-containing protein 4 OS=Homo sapiens OX=9606 GN=NLRC4 PE=1 SV=2
9	Q9Y2G2	0.002	38.1	537	0.245	0.050	CARD8_HUMAN Caspase recruitment domain-containing protein 8 OS=Homo sapiens OX=9606 GN=CARD8 PE=1 SV=2
10	E9PMT1	0.005	36.6	147	0.245	0.184	E9PMT1_HUMAN Caspase 4 (Fragment) OS=Homo sapiens OX=9606 GN=CASP4 PE=1 SV=1
11	O75601	0.007	37.0	377	0.236	0.069	CASPD_BOVIN Caspase-13 OS=Bos taurus OX=9913 GN=CASP13 PE=1 SV=1
12	P49662	0.014	35.8	377	0.209	0.061	CASP4_HUMAN Caspase-4 OS=Homo sapiens OX=9606 GN=CASP4 PE=1 SV=1
13	A0A8I6ADV9	0.016	35.8	537	0.182	0.037	A0A8I6ADV9_RAT Baculoviral IAP repeat-containing 2 OS=Rattus norvegicus OX=10116 GN=Birc2 PE=4 SV=1
14	Q6P6S1	0.019	35.4	589	0.182	0.034	Q6P6S1_RAT Baculoviral IAP repeat-containing 2 OS=Rattus norvegicus OX=10116 GN=Birc2 PE=3 SV=1
15	D4A5W3	0.054	34.3	932	0.200	0.024	D4A5W3_RAT Nucleotide-binding oligomerization domain containing 2 OS=Rattus norvegicus OX=10116 GN=Nod2 PE=3 SV=1
16	A0A0G2K4Z7	0.056	34.3	1034	0.200	0.021	A0A0G2K4Z7_RAT Nucleotide-binding oligomerization domain containing 2 OS=Rattus norvegicus OX=10116 GN=Nod2 PE=3 SV=2
17	A0A1D5NSB4	0.068	33.9	513	0.164	0.035	A0A1D5NSB4_DANRE Adhesion G protein-coupled receptor G1 OS=Danio rerio OX=7955 GN=si:dkey-181f22.4 PE=4 SV=1
18	Q6E804	0.083	33.9	1013	0.191	0.021	NOD2_BOVIN Nucleotide-binding oligomerization domain-containing protein 2 OS=Bos taurus OX=9913 GN=NOD2 PE=2 SV=1
19	Q80SY9	0.10	33.5	1013	0.209	0.023	Q80SY9_MOUSE NOD2 OS=Mus musculus OX=10090 GN=Nod2 PE=2 SV=1
20	Q8K3Z0	0.10	33.5	1020	0.209	0.023	NOD2_MOUSE Nucleotide-binding oligomerization domain-containing protein 2 OS=Mus musculus OX=10090 GN=Nod2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00619 CARD	2.6e-21	86.7	Caspase recruitment domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000364859

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000433138	0.965	Caspase-1
2	9606.ENSP00000364858	0.850	Caspase recruitment domain-containing protein 16
3	9606.ENSP00000436691	0.845	Caspase recruitment domain-containing protein 18
4	9606.ENSP00000247470	0.766	Apoptosis-associated speck-like protein containing a CARD
5	9606.ENSP00000385090	0.762	NLR family CARD domain-containing protein 4
6	9606.ENSP00000219596	0.726	Pyrin
7	9606.ENSP00000337383	0.707	NACHT, LRR and PYD domains-containing protein 3
8	9606.ENSP00000376849	0.675	Caspase-5
9	9606.ENSP00000357112	0.672	Interferon-inducible protein AIM2
10	9606.ENSP00000292174	0.637	C-X-C chemokine receptor type 5
11	9606.ENSP00000300589	0.598	Nucleotide-binding oligomerization domain-containing protein 2
12	9606.ENSP00000263341	0.579	Interleukin-1 beta
13	9606.ENSP00000388566	0.567	Caspase-4
14	9606.ENSP00000448165	0.554	Apoptotic protease-activating factor 1
15	9606.ENSP00000280357	0.543	Interleukin-18
16	9606.ENSP00000467123	0.522	NACHT, LRR and PYD domains-containing protein 7
17	9606.ENSP00000381857	0.506	Maestro heat like repeat family member 6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	0.999	identical protein binding
GO:0089720	0.999	caspase binding
GO:0019904	0.979	protein domain specific binding
GO:0050700	0.600	CARD domain binding
GO:0098772	0.514	molecular function regulator activity
GO:0030234	0.407	enzyme regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071222	0.991	cellular response to lipopolysaccharide
GO:0032692	0.986	negative regulation of interleukin-1 production
GO:0032651	0.978	regulation of interleukin-1 beta production
GO:0050794	0.860	regulation of cellular process
GO:0048518	0.795	positive regulation of biological process
GO:0080090	0.787	regulation of primary metabolic process
GO:0051171	0.787	regulation of nitrogen compound metabolic process
GO:0065009	0.746	regulation of molecular function
GO:0051246	0.730	regulation of protein metabolic process
GO:0050790	0.705	regulation of catalytic activity
GO:0048583	0.682	regulation of response to stimulus
GO:0010604	0.658	positive regulation of macromolecule metabolic process
GO:0048522	0.577	positive regulation of cellular process
GO:0030162	0.546	regulation of proteolysis
GO:0051336	0.533	regulation of hydrolase activity
GO:0052547	0.524	regulation of peptidase activity
GO:0044093	0.516	positive regulation of molecular function
GO:2000116	0.494	regulation of cysteine-type endopeptidase activity
GO:0032101	0.482	regulation of response to external stimulus
GO:0043067	0.456	regulation of programmed cell death
GO:0010628	0.438	positive regulation of gene expression
GO:0042981	0.425	regulation of apoptotic process
GO:0001819	0.413	positive regulation of cytokine production
GO:0006950	0.394	response to stress
GO:0051173	0.355	positive regulation of nitrogen compound metabolic process
GO:0010646	0.345	regulation of cell communication
GO:0051090	0.345	regulation of DNA-binding transcription factor activity
GO:0048584	0.337	positive regulation of response to stimulus
GO:0023051	0.335	regulation of signaling
GO:0009966	0.331	regulation of signal transduction
GO:0008152	0.329	metabolic process
GO:0051247	0.324	positive regulation of protein metabolic process
GO:0048523	0.307	negative regulation of cellular process
GO:0031347	0.302	regulation of defense response
GO:0032691	0.302	negative regulation of interleukin-1 beta production
GO:0032732	0.301	positive regulation of interleukin-1 production

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	0.999	protein-containing complex
GO:0110165	0.844	cellular anatomical entity
GO:0005829	0.360	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]