StarFunc result for job id Q5XPI4

User Input

>input (1314 residues)
MASKGAGMSFSRKSYRLTSDAEKSRVTGIVQEKLLNDYLNRIFSSSEHAPPAATSRKPLN
FQNLPEHLDQLLQVDNEEEESQGQVEGRLGPSTVVLDHTGGFEGLLLVDDDLLGVIGHSN
FGTIRSTTCVYKGKWLYEVLISSQGLMQIGWCTISCRFNQEEGVGDTHNSYAYDGNRVRK
WNVTTTNYGKAWAAGDIVSCLIDLDDGTLSFCLNGVSLGTAFENLSRGLGMAYFPAISLS
FKESVAFNFGSRPLRYPVAGYRPLQDPPSADLVRAQRLLGCFRAVLSVELDPVEGRLLDK
ESSKWRLRGQPTVLLTLAHIFHHFAPLLRKVYLVEAVLMSFLLGIVEKGTPTQAQSVVHQ
VLDLLWLFMEDYEVQDCLKQLMMSLLRLYRFSPIVPDLGLQIHYLRLTIAILRHEKSRKF
LLSNVLFDVLRSVVFFYIKSPLRVEEAGLQELIPTTWWPHCSSREGKESTEMKEETAEER
LRRRAYERGCQRLRKRIEVVEELQVQILKLLLDNKDDNGGEASRYIFLTKFRKFLQENAS
GRGNMPMLCPPEYMVCFLHRLISALRYYWDEYKASNPHASFSEEAYIPPQVFYNGKVDYF
DLQRLGGLLSHLRKTLKDDLASKANIVIDPLELQSTAMDDLDEDEEPAPAMAQRPMQALA
VGGPLPLPRPGWLSSPTLGRANRFLSTAAVSLMTPRRPLSTSEKVKVRTLSVEQRTREDI
EGSHWNEGLLLGRPPEEPEQPLTENSLLEVLDGAVMMYNLSVHQQLGKMVGVSDDVNEYA
MALRDTEDKLRRCPKRRKDILAELTKSQKVFSEKLDHLSRRLAWVHATVYSQEKMLDIYW
LLRVCLRTIEHGDRTGSLFAFMPEFYLSVAINSYSALKNYFGPVHSMEELPGYEETLTRL
AAILAKHFADARIVGTDIRDSLMQALASYVCYPHSLRAVERIPEEQRIAMVRNLLAPYEQ
RPWAQTNWILVRLWRGCGFGYRYTRLPHLLKTKLEDANLPSLQKPCPSTLLQQHMADLLQ
QGPDVAPSFLNSVLNQLNWAFSEFIGMIQEIQQAAERLERNFVDSRQLKVCATCFDLSVS
LLRVLEMTITLVPEIFLDWTRPTSEMLLRRLAQLLNQVLNRVTAERNLFDRVVTLRLPGL
ESVDHYPILVAVTGILVQLLVRGPASEREQATSVLLADPCFQLRSICYLLGQPEPPAPGT
ALPAPDRKRFSLQSYADYISADELAQVEQMLAHLTSASAQAAAASLPTSEEDLCPICYAH
PISAVFQPCGHKSCKACINQHLMNNKDCFFCKTTIVSVEDWEKGANTSTTSSAA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5XPI4	1.000	1.000	0.000	1314	1.000	1.000	Q5XPI4.pdb.gz	RN123_HUMAN E3 ubiquitin-protein ligase RNF123 OS=Homo sapiens OX=9606 GN=RNF123 PE=1 SV=1
2	AFDB:Q9VFC4	0.732	0.723	1.680E-68	1332	0.298	0.294	Q9VFC4.pdb.gz	Q9VFC4_DROME RING-type E3 ubiquitin transferase OS=Drosophila melanogaster OX=7227 GN=Kpc1 PE=1 SV=1
3	AFDB:Q9SIZ8	0.666	0.682	3.408E-52	1280	0.247	0.253	Q9SIZ8.pdb.gz	RKP_ARATH E3 ubiquitin-protein ligase RKP OS=Arabidopsis thaliana OX=3702 GN=RKP PE=2 SV=2
4	AFDB:Q09349	0.410	0.523	1.390E-14	984	0.102	0.136	Q09349.pdb.gz	UBE4_CAEEL Ubiquitin conjugation factor E4 ufd-2 OS=Caenorhabditis elegans OX=6239 GN=ufd-2 PE=1 SV=2
5	AFDB:P54860	0.411	0.531	3.488E-13	961	0.098	0.134	P54860.pdb.gz	UFD2_YEAST E4 ubiquitin-protein ligase UFD2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UFD2 PE=1 SV=3
6	PDB:3m62A	0.382	0.500	8.804E-13	955	0.102	0.140	3m62A.pdb.gz
7	AFDB:A3RJH1	0.121	0.212	1.060E-9	740	0.046	0.082	A3RJH1.pdb.gz	A3RJH1_HUMAN ATP-dependent RNA helicase OS=Homo sapiens OX=9606 GN=DDX1 PE=2 SV=1
8	AFDB:F1RAW8	0.124	0.271	1.060E-9	590	0.056	0.125	F1RAW8.pdb.gz	F1RAW8_DANRE Ash2-like, histone lysine methyltransferase complex subunit OS=Danio rerio OX=7955 GN=fb34c06 PE=1 SV=1
9	AFDB:Q9VNV3	0.126	0.225	1.485E-9	727	0.044	0.080	Q9VNV3.pdb.gz	DDX1_DROME ATP-dependent RNA helicase Ddx1 OS=Drosophila melanogaster OX=7227 GN=Ddx1 PE=2 SV=1
10	AFDB:Q9UBL3	0.126	0.260	1.931E-9	628	0.058	0.121	Q9UBL3.pdb.gz	ASH2L_HUMAN Set1/Ash2 histone methyltransferase complex subunit ASH2 OS=Homo sapiens OX=9606 GN=ASH2L PE=1 SV=1
11	AFDB:Q4Z8K6	0.116	0.157	4.241E-9	962	0.082	0.112	Q4Z8K6.pdb.gz	RBP9X_DROME Ran-binding proteins 9/10 homolog OS=Drosophila melanogaster OX=7227 GN=RanBPM PE=1 SV=1
12	PDB:7u9tA	0.125	0.062	6.102E-9	4229	0.151	0.047	7u9tA.pdb.gz	Structural analyses of human ryanodine receptor type 2 channels reveal the mechanisms for sudden cardiac death and treatment.
13	PDB:7ua3A	0.141	0.061	1.500E-8	4443	0.149	0.044	7ua3A.pdb.gz	Structural analyses of human ryanodine receptor type 2 channels reveal the mechanisms for sudden cardiac death and treatment.
14	PDB:7nscA	0.118	0.536	3.974E-8	276	0.043	0.203	7nscA.pdb.gz
15	PDB:6wotA	0.104	0.045	1.135E-7	4197	0.134	0.042	6wotA.pdb.gz	Structural mechanism of two gain-of-function cardiac and skeletal RyR mutations at an equivalent site by cryo-EM.
16	PDB:7m6aA	0.099	0.047	4.893E-7	4306	0.137	0.042	7m6aA.pdb.gz	High-resolution structure of the membrane-embedded skeletal muscle ryanodine receptor.
17	PDB:6swy1	0.109	0.244	7.389E-7	542	0.046	0.111	6swy1.pdb.gz
18	PDB:7tzcA	0.125	0.058	1.296E-6	4404	0.125	0.037	7tzcA.pdb.gz	A drug and ATP binding site in type 1 ryanodine receptor.
19	PDB:7t65A	0.116	0.055	1.506E-6	4252	0.135	0.042	7t65A.pdb.gz	Molecular mechanism of the severe MH/CCD mutation Y522S in skeletal ryanodine receptor (RyR1) by cryo-EM.
20	PDB:7vmlA	0.117	0.058	1.506E-6	4044	0.138	0.045	7vmlA.pdb.gz	Molecular basis for gating of cardiac ryanodine receptor explains the mechanisms for gain- and loss-of function mutations.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	C9J266	0.0	1548	762	0.568	0.979	C9J266_HUMAN Ring finger protein 123 OS=Homo sapiens OX=9606 GN=RNF123 PE=1 SV=1
2	Q5XPI4	0.0	2716	1314	1.000	1.000	RN123_HUMAN E3 ubiquitin-protein ligase RNF123 OS=Homo sapiens OX=9606 GN=RNF123 PE=1 SV=1
3	Q9VFC4	0.0	575	1332	0.301	0.297	Q9VFC4_DROME RING-type E3 ubiquitin transferase OS=Drosophila melanogaster OX=7227 GN=Kpc1 PE=1 SV=1
4	F4IIK4	6.83e-99	347	1283	0.247	0.253	F4IIK4_ARATH RING-type E3 ubiquitin transferase OS=Arabidopsis thaliana OX=3702 GN=RKP PE=1 SV=1
5	Q9SIZ8	8.87e-99	346	1280	0.246	0.252	RKP_ARATH E3 ubiquitin-protein ligase RKP OS=Arabidopsis thaliana OX=3702 GN=RKP PE=2 SV=2
6	I2HAA7	5.19e-18	93.2	5071	0.043	0.011	I2HAA7_CAEEL Ryanodine receptor 44F OS=Caenorhabditis elegans OX=6239 GN=unc-68 PE=1 SV=2
7	B7WN66	5.37e-18	93.2	5085	0.043	0.011	B7WN66_CAEEL Ryanodine receptor 44F OS=Caenorhabditis elegans OX=6239 GN=unc-68 PE=1 SV=5
8	Q94279	5.96e-18	93.2	5201	0.043	0.011	Q94279_CAEEL Ryanodine receptor 44F OS=Caenorhabditis elegans OX=6239 GN=unc-68 PE=1 SV=6
9	I2HAA6	6.16e-18	93.2	5187	0.043	0.011	I2HAA6_CAEEL Ryanodine receptor 44F OS=Caenorhabditis elegans OX=6239 GN=unc-68 PE=1 SV=2
10	Q92736	1.91e-16	88.2	4967	0.037	0.010	RYR2_HUMAN Ryanodine receptor 2 OS=Homo sapiens OX=9606 GN=RYR2 PE=1 SV=3
11	P30957	2.00e-16	88.2	4969	0.037	0.010	RYR2_RABIT Ryanodine receptor 2 OS=Oryctolagus cuniculus OX=9986 GN=RYR2 PE=1 SV=3
12	E9Q401	1.62e-15	85.1	4966	0.037	0.010	RYR2_MOUSE Ryanodine receptor 2 OS=Mus musculus OX=10090 GN=Ryr2 PE=1 SV=1
13	B0LPN4	1.76e-15	85.1	4953	0.037	0.010	RYR2_RAT Ryanodine receptor 2 OS=Rattus norvegicus OX=10116 GN=Ryr2 PE=1 SV=2
14	Q15413	2.18e-14	81.3	4870	0.025	0.007	RYR3_HUMAN Ryanodine receptor 3 OS=Homo sapiens OX=9606 GN=RYR3 PE=1 SV=3
15	A0A060WZC7	2.43e-14	81.3	4791	0.039	0.011	A0A060WZC7_ONCMY Skeletal muscle ryanodine receptor OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00004066001 PE=4 SV=1
16	A2AGL3	3.00e-14	80.9	4863	0.029	0.008	RYR3_MOUSE Ryanodine receptor 3 OS=Mus musculus OX=10090 GN=Ryr3 PE=1 SV=1
17	A6P4B8	8.26e-14	79.3	5076	0.034	0.009	A6P4B8_DANRE Ryanodine receptor 1 OS=Danio rerio OX=7955 GN=si:dkey-250i19.1 PE=1 SV=1
18	A0A087X2G1	8.76e-14	78.6	636	0.037	0.075	A0A087X2G1_HUMAN ATP-dependent RNA helicase OS=Homo sapiens OX=9606 GN=DDX1 PE=1 SV=2
19	Q19614	9.10e-14	77.4	433	0.034	0.104	TOFU2_CAEEL Protein tofu-2 OS=Caenorhabditis elegans OX=6239 GN=tofu-2 PE=2 SV=3
20	E9PZQ0	1.84e-13	78.6	5035	0.031	0.008	RYR1_MOUSE Ryanodine receptor 1 OS=Mus musculus OX=10090 GN=Ryr1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04216 FdhE	2.7e+02	12.8	Protein involved in formate dehydrogenase formation
2	PF00622 SPRY	1.1e-22	91.8	SPRY domain
3	PF00097 zf-C3HC4	3.8	18.8	Zinc finger, C3HC4 type (RING finger)
4	PF13923 zf-C3HC4_2	6.3e+02	11.6	Zinc finger, C3HC4 type (RING finger)
5	PF13920 zf-C3HC4_3	4.9e-06	37.6	Zinc finger, C3HC4 type (RING finger)
6	PF15227 zf-C3HC4_4	9.6e+02	11.3	zinc finger of C3HC4-type, RING
7	PF13639 zf-RING_2	0.59	21.8	Ring finger domain
8	PF14634 zf-RING_5	51	15.3	zinc-RING finger domain
9	PF13445 zf-RING_UBOX	9.8e+02	11.2	RING-type zinc-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000328287

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000360821	0.998	Ubiquitin-associated domain-containing protein 1
2	9606.ENSP00000401197	0.967	Ubiquitin carboxyl-terminal hydrolase 19
3	9606.ENSP00000228872	0.873	Cyclin-dependent kinase inhibitor 1B
4	9606.ENSP00000226574	0.754	Nuclear factor NF-kappa-B p105 subunit
5	9606.ENSP00000413592	0.742	Rieske domain-containing protein
6	9606.ENSP00000463650	0.716	E3 ubiquitin-protein ligase RNF115
7	9606.ENSP00000297661	0.698	Ubiquitin-associated protein 1
8	9606.ENSP00000482032	0.696	Inositol hexakisphosphate kinase 1
9	9606.ENSP00000305449	0.692	Metal transporter CNNM3
10	9606.ENSP00000368464	0.692	Kinesin-like protein KIF24
11	9606.ENSP00000277458	0.689	Ankyrin repeat and SOCS box protein 6
12	9606.ENSP00000263346	0.682	Transcription factor 25
13	9606.ENSP00000296456	0.677	Acylamino-acid-releasing enzyme
14	9606.ENSP00000313172	0.674	Blood vessel epicardial substance
15	9606.ENSP00000262482	0.669	E3 ubiquitin-protein ligase RNF167
16	9606.ENSP00000365256	0.650	H(+)/Cl(-) exchange transporter 5
17	9606.ENSP00000370213	0.650	H(+)/Cl(-) exchange transporter 4
18	9606.ENSP00000261514	0.648	H(+)/Cl(-) exchange transporter 3
19	9606.ENSP00000339867	0.643	Chloride channel protein 1
20	9606.ENSP00000357304	0.640	Protein BLOM7

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0019787	0.995	ubiquitin-like protein transferase activity
GO:0004842	0.994	ubiquitin-protein transferase activity
GO:0061659	0.865	ubiquitin-like protein ligase activity
GO:0061630	0.859	ubiquitin protein ligase activity
GO:0019899	0.462	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0008152	0.992	metabolic process
GO:0071704	0.971	organic substance metabolic process
GO:0006807	0.959	nitrogen compound metabolic process
GO:0044238	0.957	primary metabolic process
GO:0009987	0.947	cellular process
GO:0043170	0.922	macromolecule metabolic process
GO:0065007	0.887	biological regulation
GO:0050789	0.868	regulation of biological process
GO:0019538	0.856	protein metabolic process
GO:0050794	0.675	regulation of cellular process
GO:0044237	0.565	cellular metabolic process
GO:0050896	0.547	response to stimulus
GO:0043412	0.365	macromolecule modification
GO:0036211	0.360	protein modification process
GO:0019222	0.352	regulation of metabolic process
GO:0009057	0.345	macromolecule catabolic process
GO:0030163	0.324	protein catabolic process
GO:0006508	0.309	proteolysis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0031965	0.998	nuclear membrane
GO:0070013	0.916	intracellular organelle lumen
GO:0031981	0.303	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.997	Transferases.

[back to server]