StarFunc result for job id Q5XUX0

User Input

>input (539 residues)
MAVCARLCGVGPSRGCRRRQQRRGPAETAAADSEPDTDPEEERIEASAGVGGGLCAGPSP
PPPRCSLLELPPELLVEIFASLPGTDLPSLAQVCTKFRRILHTDTIWRRRCREEYGVCEN
LRKLEITGVSCRDVYAKLLHRYRHILGLWQPDIGPYGGLLNVVVDGLFIIGWMYLPPHDP
HVDDPMRFKPLFRIHLMERKAATVECMYGHKGPHHGHIQIVKKDEFSTKCNQTDHHRMSG
GRQEEFRTWLREEWGRTLEDIFHEHMQELILMKFIYTSQYDNCLTYRRIYLPPSRPDDLI
KPGLFKGTYGSHGLEIVMLSFHGRRARGTKITGDPNIPAGQQTVEIDLRHRIQLPDLENQ
RNFNELSRIVLEVRERVRQEQQEGGHEAGEGRGRQGPRESQPSPAQPRAEAPSKGPDGTP
GEDGGEPGDAVAAAEQPAQCGQGQPFVLPVGVSSRNEDYPRTCRMCFYGTGLIAGHGFTS
PERTPGVFILFDEDRFGFVWLELKSFSLYSRVQATFRNADAPSPQAFDEMLKNIQSLTS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5XUX0	1.000	1.000	1.616E-102	539	1.000	1.000	Q5XUX0.pdb.gz	FBX31_HUMAN F-box only protein 31 OS=Homo sapiens OX=9606 GN=FBXO31 PE=1 SV=2
2	AFDB:B2RYN2	0.805	0.856	1.117E-90	507	0.855	0.909	B2RYN2.pdb.gz	FBX31_RAT F-box only protein 31 OS=Rattus norvegicus OX=10116 GN=Fbxo31 PE=1 SV=1
3	AFDB:Q94AT5	0.366	0.311	4.518E-12	651	0.156	0.129	Q94AT5.pdb.gz	EXEC2_ARATH Protein EXECUTER 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=EX2 PE=2 SV=1
4	AFDB:Q8NCQ5	0.108	0.113	7.445E-5	510	0.108	0.114	Q8NCQ5.pdb.gz	FBX15_HUMAN F-box only protein 15 OS=Homo sapiens OX=9606 GN=FBXO15 PE=1 SV=2
5	AFDB:Q54DE4	0.129	0.131	2.741E-4	530	0.056	0.057	Q54DE4.pdb.gz	Q54DE4_DICDI Uncharacterized protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0292312 PE=4 SV=1
6	AFDB:Q94AD8	0.172	0.172	5.259E-4	539	0.150	0.150	Q94AD8.pdb.gz	FBW3_ARATH F-box/WD-40 repeat-containing protein At5g21040 OS=Arabidopsis thaliana OX=3702 GN=At5g21040 PE=2 SV=1
7	AFDB:O75426	0.145	0.137	2.406E-3	580	0.089	0.083	O75426.pdb.gz	FBX24_HUMAN F-box only protein 24 OS=Homo sapiens OX=9606 GN=FBXO24 PE=1 SV=2
8	AFDB:Q54R82	0.128	0.082	4.874E-3	942	0.115	0.066	Q54R82.pdb.gz	MKKA_DICDI Mitogen-activated protein kinase kinase kinase A OS=Dictyostelium discoideum OX=44689 GN=mkkA PE=1 SV=2
9	AFDB:E2JEI9	0.138	0.144	5.736E-3	514	0.030	0.031	E2JEI9.pdb.gz	E2JEI9_ONCMY Oocyte-specific F-box protein OS=Oncorhynchus mykiss OX=8022 GN=Fbos PE=2 SV=1
10	PDB:6ttuT	0.131	0.168	5.954E-3	394	0.072	0.099	6ttuT.pdb.gz	NEDD8 nucleates a multivalent cullin-RING-UBE2D ubiquitin ligation assembly.
11	AFDB:Q8IXX5	0.121	0.166	6.056E-3	376	0.054	0.077	Q8IXX5.pdb.gz	T183A_HUMAN Transmembrane protein 183A OS=Homo sapiens OX=9606 GN=TMEM183A PE=1 SV=2
12	PDB:7z8bF	0.118	0.136	1.582E-2	457	0.063	0.074	7z8bF.pdb.gz	Structure of CRL7 FBXW8 reveals coupling with CUL1-RBX1/ROC1 for multi-cullin-RING E3-catalyzed ubiquitin ligation.
13	PDB:7b5mT	0.080	0.131	9.498E-2	325	0.026	0.043	7b5mT.pdb.gz	Ubiquitin ligation to F-box protein targets by SCF-RBR E3-E3 super-assembly.
14	PDB:7snsC	0.117	0.293	9.498E-2	172	0.030	0.093	7snsC.pdb.gz
15	PDB:2e31A	0.126	0.244	1.118E-1	246	0.045	0.098	2e31A.pdb.gz
16	PDB:4a60A	0.117	0.330	1.822E-1	141	0.033	0.128	4a60A.pdb.gz
17	PDB:3wsoA	0.103	0.199	2.265E-1	252	0.041	0.087	3wsoA.pdb.gz
18	PDB:6o60C	0.076	0.105	2.265E-1	389	0.022	0.031	6o60C.pdb.gz	GGTase3 is a newly identified geranylgeranyltransferase targeting a ubiquitin ligase.
19	PDB:4bj8O	0.086	0.287	2.814E-1	122	0.020	0.090	4bj8O.pdb.gz	Zebavidin
20	PDB:7snrB	0.116	0.328	2.814E-1	153	0.020	0.072	7snrB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B2RYN2	0.0	884	507	0.857	0.911	FBX31_RAT F-box only protein 31 OS=Rattus norvegicus OX=10116 GN=Fbxo31 PE=1 SV=1
2	Q3TQF0	0.0	894	507	0.863	0.917	FBX31_MOUSE F-box only protein 31 OS=Mus musculus OX=10090 GN=Fbxo31 PE=1 SV=1
3	Q5XUX0	0.0	1110	539	1.000	1.000	FBX31_HUMAN F-box only protein 31 OS=Homo sapiens OX=9606 GN=FBXO31 PE=1 SV=2
4	Q04511	2.97e-04	46.2	668	0.033	0.027	UFO1_YEAST Ubiquitin ligase complex F-box protein UFO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UFO1 PE=1 SV=1
5	Q94AT5	4.16e-04	45.4	651	0.065	0.054	EXEC2_ARATH Protein EXECUTER 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=EX2 PE=2 SV=1
6	Q9VF10	0.002	43.1	772	0.056	0.039	Q9VF10_DROME F-box and leucine-rich repeat protein 7 OS=Drosophila melanogaster OX=7227 GN=Fbxl7 PE=1 SV=2
7	Q22071	0.003	42.4	406	0.041	0.054	MEC15_CAEEL F-box/WD repeat-containing protein mec-15 OS=Caenorhabditis elegans OX=6239 GN=mec-15 PE=1 SV=1
8	O75426	0.006	41.6	580	0.035	0.033	FBX24_HUMAN F-box only protein 24 OS=Homo sapiens OX=9606 GN=FBXO24 PE=1 SV=2
9	Q9XI00	0.009	40.8	328	0.041	0.067	SKI32_ARATH F-box protein 7 OS=Arabidopsis thaliana OX=3702 GN=SKIP32 PE=1 SV=1
10	Q9ZUB8	0.009	41.2	475	0.043	0.048	SKI22_ARATH F-box protein SKIP22 OS=Arabidopsis thaliana OX=3702 GN=SKIP22 PE=1 SV=1
11	Q9VH60	0.020	40.4	1182	0.033	0.015	Q9VH60_DROME F-box protein 11, isoform A OS=Drosophila melanogaster OX=7227 GN=FBXO11 PE=4 SV=1
12	Q8W420	0.037	39.3	611	0.039	0.034	ADO2_ARATH Adagio protein 2 OS=Arabidopsis thaliana OX=3702 GN=ADO2 PE=1 SV=1
13	Q8GZV6	0.046	38.9	776	0.032	0.022	Q8GZV6_ORYSJ BHLH domain-containing protein OS=Oryza sativa subsp. japonica OX=39947 GN=OJ1017C11.10 PE=3 SV=1
14	Q9ZUB9	0.064	38.1	350	0.058	0.089	FB17_ARATH Putative F-box protein At1g23770 OS=Arabidopsis thaliana OX=3702 GN=At1g23770 PE=4 SV=1
15	P57775	0.073	38.1	412	0.039	0.051	FBXW4_HUMAN F-box/WD repeat-containing protein 4 OS=Homo sapiens OX=9606 GN=FBXW4 PE=1 SV=1
16	Q0VGT7	0.084	37.7	347	0.030	0.046	Q0VGT7_MOUSE Fbxw7 protein OS=Mus musculus OX=10090 GN=Fbxw7 PE=2 SV=1
17	Q8BK26	0.091	37.4	255	0.032	0.067	FBX44_MOUSE F-box only protein 44 OS=Mus musculus OX=10090 GN=Fbxo44 PE=1 SV=1
18	Q9NXK8	0.10	37.4	326	0.030	0.049	FXL12_HUMAN F-box/LRR-repeat protein 12 OS=Homo sapiens OX=9606 GN=FBXL12 PE=1 SV=1
19	Q8VBV4	0.12	37.7	710	0.030	0.023	FBXW7_MOUSE F-box/WD repeat-containing protein 7 OS=Mus musculus OX=10090 GN=Fbxw7 PE=1 SV=2
20	Q9NRD1	0.12	37.0	293	0.032	0.058	FBX6_HUMAN F-box only protein 6 OS=Homo sapiens OX=9606 GN=FBXO6 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12014 Cyclin_D1_bind	7.3e-54	193.8	Cyclin D1 binding domain
2	PF00646 F-box	1.1e-06	39.6	F-box domain
3	PF12937 F-box-like	1.8e-08	45.5	F-box-like
4	PF15966 F-box_4	2.4e+02	13.0	F-box

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000310841

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000231487	0.992	S-phase kinase-associated protein 1
2	9606.ENSP00000227507	0.978	G1/S-specific cyclin-D1
3	9606.ENSP00000326804	0.964	Cullin-1
4	9606.ENSP00000216225	0.764	E3 ubiquitin-protein ligase RBX1
5	9606.ENSP00000250495	0.612	NEDD8
6	9606.ENSP00000269305	0.573	Cellular tumor antigen p53
7	9606.ENSP00000419199	0.563	Ankyrin repeat and SOCS box protein 14
8	9606.ENSP00000278616	0.541	Serine-protein kinase ATM
9	9606.ENSP00000352282	0.531	Kelch domain containing 1
10	9606.ENSP00000455079	0.504	Uncharacterized protein C16orf95

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0030332	1.000	cyclin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.996	regulation of biological process
GO:0050794	0.993	regulation of cellular process
GO:0044237	0.991	cellular metabolic process
GO:0051603	0.987	proteolysis involved in protein catabolic process
GO:0050896	0.977	response to stimulus
GO:0043161	0.977	proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0035556	0.971	intracellular signal transduction
GO:1903047	0.961	mitotic cell cycle process
GO:0048523	0.961	negative regulation of cellular process
GO:0051726	0.958	regulation of cell cycle
GO:0006974	0.936	cellular response to DNA damage stimulus
GO:0045930	0.932	negative regulation of mitotic cell cycle
GO:0000077	0.930	DNA damage checkpoint signaling
GO:0031146	0.911	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process
GO:1901991	0.903	negative regulation of mitotic cell cycle phase transition
GO:0044773	0.899	mitotic DNA damage checkpoint signaling
GO:0048518	0.889	positive regulation of biological process
GO:1902807	0.882	negative regulation of cell cycle G1/S phase transition
GO:2000134	0.850	negative regulation of G1/S transition of mitotic cell cycle
GO:0048522	0.775	positive regulation of cellular process
GO:0044819	0.752	mitotic G1/S transition checkpoint signaling
GO:0031145	0.464	anaphase-promoting complex-dependent catabolic process
GO:0019222	0.371	regulation of metabolic process
GO:0060255	0.347	regulation of macromolecule metabolic process
GO:0080090	0.345	regulation of primary metabolic process
GO:0051171	0.345	regulation of nitrogen compound metabolic process
GO:0036211	0.330	protein modification process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.998	cytoplasm
GO:0043229	0.992	intracellular organelle
GO:0005829	0.987	cytosol
GO:0032991	0.977	protein-containing complex
GO:0043232	0.970	intracellular non-membrane-bounded organelle
GO:0043227	0.953	membrane-bounded organelle
GO:0043231	0.943	intracellular membrane-bounded organelle
GO:0031461	0.886	cullin-RING ubiquitin ligase complex
GO:0070013	0.879	intracellular organelle lumen
GO:0031981	0.781	nuclear lumen
GO:0019005	0.694	SCF ubiquitin ligase complex
GO:0005654	0.547	nucleoplasm
GO:0005815	0.410	microtubule organizing center
GO:0016020	0.302	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]