StarFunc result for job id Q5XX13

User Input

>input (1052 residues)
MENLESRLKNAPYFRCEKGTDSIPLCRKCETCVLAWKIFSTKEWFCRINDISQRRFLVGI
LKQLNSLYLLHYFQNILQTTQGKDFIYNRSRINLSKKEGKVVKSSLNQMLDKTVEQKMKE
ILYWFANSTQWTKANYTLLLLQMCNPKLLLTAANVIRVLFLREENNISGLNQDITDVCFS
PEKDHSSKSATSQVYWTAKTQHTSLPLSKAPENEHLLGAASNPEEPWRNSLRCISEMNRL
FSGKGDITKPGYDPCNLLVDLDDIRDLSSGFSKYRDFIRYLPIHLSKYILRMLDRHTLNK
CASVSQHWAAMAQQVKMDLSAHGFIQNQITFLQGSYTRGIDPNYANKVSIPVPKMVDDGK
SMRVKHPKWKLRTKNEYNLWTAYQNEETQQVLIEERNVFCGTYNVRILSDTWDQNRVIHY
SGGDLIAVSSNRKIHLLDIIQVKAIPVEFRGHAGSVRALFLCEEENFLLSGSYDLSIRYW
DLKSGVCTRIFGGHQGTITCMDLCKNRLVSGGRDCQVKVWDVDTGKCLKTFRHKDPILAT
RINDTYIVSSCERGLVKVWHIAMAQLVKTLSGHEGAVKCLFFDQWHLLSGSTDGLVMAWS
MVGKYERCLMAFKHPKEVLDVSLLFLRVISACADGKIRIYNFLNGNCMKVLKANGRGDPV
LSFFIQGNRMVVNTESNVLMFQFEHIKWQYAVEKTKQKKNKEKEEEKEENSLMEILSKCN
IQVHSPRESVSSKQTVIQELLPGKPPKSRVLLKPAKFSSAVLIEELQSQGKSKSPRRDAD
DVEKAQKQGQLETPGKLPSHPKKKSWKIPMSPDQFLLTVSALQHAHNSGEFAYPCRPQTE
ITDVWGPSISYPRKVLNFKGKSIQRAVDRLRLSNPPIDVKRTSIPLEIQKLQPNLKISLH
SPRVQSTIPQPMIIRSRFSGSLKGGDQVTSSIERAVCSTGPLTSMQVIKPNRMLAPQVGT
ATLSLKKERPRIYTALDPFRVNTEFVLLTVKEEKEHQEAKMKEYQARESTGVVDPGKVSK
AAWIRKIKGLPIDNFTKQGKTAAPELGQNVFI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5XX13	1.000	1.000	0.000	1052	1.000	1.000	Q5XX13.pdb.gz	FBW10_HUMAN F-box/WD repeat-containing protein 10 OS=Homo sapiens OX=9606 GN=FBXW10 PE=2 SV=2
2	PDB:6ttuT	0.255	0.661	2.869E-20	394	0.080	0.213	6ttuT.pdb.gz	NEDD8 nucleates a multivalent cullin-RING-UBE2D ubiquitin ligation assembly.
3	AFDB:A0A1P8AW69	0.246	0.253	3.929E-20	1019	0.111	0.115	A0A1P8AW69.pdb.gz	KTN81_ARATH Katanin p80 WD40 repeat-containing subunit B1 homolog KTN80.1 OS=Arabidopsis thaliana OX=3702 GN=KTN80.1 PE=1 SV=1
4	PDB:2h9lA	0.246	0.761	5.862E-20	321	0.073	0.240	2h9lA.pdb.gz
5	PDB:5mzhB	0.238	0.573	1.627E-19	415	0.069	0.176	5mzhB.pdb.gz
6	PDB:3dm0A	0.246	0.376	2.710E-19	675	0.069	0.108	3dm0A.pdb.gz	Structure of a signal transduction regulator, RACK1, from Arabidopsis thaliana.
7	PDB:7mq8LR	0.242	0.326	1.702E-18	773	0.073	0.100	7mq8LR.pdb.gz	Nucleolar maturation of the human small subunit processome.
8	PDB:1vyhC	0.237	0.766	3.851E-18	310	0.067	0.229	1vyhC.pdb.gz
9	PDB:5k1aF	0.241	0.413	8.282E-18	600	0.067	0.118	5k1aF.pdb.gz	Allosteric Activation of Ubiquitin-Specific Proteases by beta-Propeller Proteins UAF1 and WDR20.
10	PDB:7mq8SG	0.246	0.639	8.282E-18	389	0.058	0.157	7mq8SG.pdb.gz	Nucleolar maturation of the human small subunit processome.
11	PDB:5nnzA	0.234	0.691	1.692E-17	335	0.061	0.191	5nnzA.pdb.gz
12	PDB:5yzgs	0.247	0.656	3.122E-17	374	0.051	0.144	5yzgs.pdb.gz	Structure of a human catalytic step I spliceosome
13	AFDB:F1QAL1	0.207	0.314	8.303E-17	677	0.103	0.160	F1QAL1.pdb.gz	F1QAL1_DANRE NEDD1 gamma-tubulin ring complex targeting factor OS=Danio rerio OX=7955 GN=fb78g03 PE=1 SV=3
14	AFDB:U4PCM1	0.243	0.313	4.040E-16	809	0.092	0.120	U4PCM1.pdb.gz	WDR33_CAEEL pre-mRNA 3' end processing protein pfs-2 OS=Caenorhabditis elegans OX=6239 GN=pfs-2 PE=1 SV=2
15	AFDB:B3H5K9	0.233	0.307	7.453E-16	782	0.089	0.120	B3H5K9.pdb.gz	NEDD1_ARATH Protein NEDD1 OS=Arabidopsis thaliana OX=3702 GN=NEDD1 PE=2 SV=1
16	AFDB:Q9VC96	0.224	0.112	1.677E-14	2232	0.091	0.043	Q9VC96.pdb.gz	Q9VC96_DROME BRWD3 OS=Drosophila melanogaster OX=7227 GN=BRWD3 PE=1 SV=2
17	AFDB:Q9C0J8	0.245	0.195	4.202E-14	1336	0.094	0.074	Q9C0J8.pdb.gz	WDR33_HUMAN pre-mRNA 3' end processing protein WDR33 OS=Homo sapiens OX=9606 GN=WDR33 PE=1 SV=2
18	AFDB:Q921C3	0.226	0.109	4.397E-13	2304	0.097	0.044	Q921C3.pdb.gz	BRWD1_MOUSE Bromodomain and WD repeat-containing protein 1 OS=Mus musculus OX=10090 GN=Brwd1 PE=1 SV=2
19	AFDB:P35658	0.228	0.120	8.064E-12	2090	0.100	0.050	P35658.pdb.gz	NU214_HUMAN Nuclear pore complex protein Nup214 OS=Homo sapiens OX=9606 GN=NUP214 PE=1 SV=2
20	AFDB:D6W4T8	0.229	0.192	2.342E-10	1266	0.075	0.062	D6W4T8.pdb.gz	D6W4T8_DROME Coronin OS=Drosophila melanogaster OX=7227 GN=pod1 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	H0Y626	0.0	956	953	0.423	0.467	H0Y626_HUMAN B box-type domain-containing protein OS=Homo sapiens OX=9606 PE=4 SV=2
2	Q5XX13	0.0	2192	1052	1.000	1.000	FBW10_HUMAN F-box/WD repeat-containing protein 10 OS=Homo sapiens OX=9606 GN=FBXW10 PE=2 SV=2
3	Q8VBV4	1.67e-28	125	710	0.092	0.137	FBXW7_MOUSE F-box/WD repeat-containing protein 7 OS=Mus musculus OX=10090 GN=Fbxw7 PE=1 SV=2
4	Q969H0	3.54e-28	124	707	0.091	0.136	FBXW7_HUMAN F-box/WD repeat-containing protein 7 OS=Homo sapiens OX=9606 GN=FBXW7 PE=1 SV=1
5	Q9VZF4	5.57e-28	124	1326	0.067	0.053	FBXW7_DROME F-box/WD repeat-containing protein 7 OS=Drosophila melanogaster OX=7227 GN=ago PE=1 SV=1
6	B7ZDC8	1.87e-26	117	544	0.089	0.173	B7ZDC8_DANRE F-box and WD repeat domain-containing 7 OS=Danio rerio OX=7955 GN=fbxw7 PE=4 SV=1
7	P87053	3.29e-26	117	605	0.106	0.183	POF1_SCHPO F-box/WD repeat-containing protein pof1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pof1 PE=1 SV=1
8	Q09990	3.09e-25	114	665	0.091	0.144	LIN23_CAEEL F-box/WD repeat-containing protein lin-23 OS=Caenorhabditis elegans OX=6239 GN=lin-23 PE=1 SV=2
9	P90648	3.90e-21	102	732	0.067	0.096	MHCKB_DICDI Myosin heavy chain kinase B OS=Dictyostelium discoideum OX=44689 GN=mhkB PE=1 SV=1
10	Q5SRY7	1.28e-20	99.4	542	0.055	0.107	FBW1B_MOUSE F-box/WD repeat-containing protein 11 OS=Mus musculus OX=10090 GN=Fbxw11 PE=1 SV=1
11	Q9UKB1	2.34e-20	98.6	542	0.055	0.107	FBW1B_HUMAN F-box/WD repeat-containing protein 11 OS=Homo sapiens OX=9606 GN=FBXW11 PE=1 SV=1
12	Q93794	4.02e-20	98.2	587	0.057	0.102	SEL10_CAEEL F-box/WD repeat-containing protein sel-10 OS=Caenorhabditis elegans OX=6239 GN=sel-10 PE=1 SV=3
13	A0A2R8QFQ6	5.61e-20	97.4	562	0.086	0.160	FB11A_DANRE F-box and WD repeat domain-containing 11-A OS=Danio rerio OX=7955 GN=fbxw11a PE=2 SV=1
14	Q91854	1.11e-19	96.3	518	0.053	0.108	TRCB_XENLA Beta-TrCP OS=Xenopus laevis OX=8355 GN=fbxw1 PE=1 SV=1
15	A0A2R8RWN9	1.58e-19	95.9	534	0.087	0.170	FB11B_DANRE F-box and WD repeat domain-containing 11-B OS=Danio rerio OX=7955 GN=fbxw11b PE=2 SV=1
16	O14170	1.79e-19	96.7	703	0.054	0.081	POP2_SCHPO WD repeat-containing protein pop2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pop2 PE=1 SV=1
17	Q9Y297	1.95e-19	95.9	605	0.053	0.093	FBW1A_HUMAN F-box/WD repeat-containing protein 1A OS=Homo sapiens OX=9606 GN=BTRC PE=1 SV=1
18	A0A0S2Z507	2.10e-19	95.9	636	0.053	0.088	A0A0S2Z507_HUMAN Beta-transducin repeat containing isoform 3 (Fragment) OS=Homo sapiens OX=9606 GN=BTRC PE=1 SV=1
19	Q803D2	2.74e-19	94.0	410	0.072	0.185	LIS1B_DANRE Lissencephaly-1 homolog B OS=Danio rerio OX=7955 GN=pafah1b1b PE=2 SV=3
20	B7Z3H4	3.56e-19	95.1	579	0.053	0.097	B7Z3H4_HUMAN Beta-transducin repeat containing E3 ubiquitin protein ligase OS=Homo sapiens OX=9606 GN=BTRC PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12894 ANAPC4_WD40	0.014	27.0	Anaphase-promoting complex subunit 4 WD40 domain
2	PF00646 F-box	97	14.3	F-box domain
3	PF12937 F-box-like	4.5e+02	12.2	F-box-like
4	PF20426 NBCH_WD40	0.01	26.3	Neurobeachin beta propeller domain
5	PF11715 Nup160	7.1	16.9	Nucleoporin Nup120/160
6	PF07830 PP2C_C	3.6e+02	13.0	Protein serine/threonine phosphatase 2C, C-terminal domain
7	PF00400 WD40	6.9e-17	72.7	WD domain, G-beta repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000379025

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000231487	0.862	S-phase kinase-associated protein 1
2	9606.ENSP00000326804	0.830	Cullin-1
3	9606.ENSP00000376945	0.741	F-box/WD repeat-containing protein 9
4	9606.ENSP00000359149	0.733	F-box/WD repeat-containing protein 4
5	9606.ENSP00000305654	0.706	Trans-golgi network vesicle protein 23 homolog B
6	9606.ENSP00000313034	0.686	F-box/WD repeat-containing protein 5
7	9606.ENSP00000216225	0.670	E3 ubiquitin-protein ligase RBX1
8	9606.ENSP00000428646	0.641	F-box only protein 41
9	9606.ENSP00000250495	0.630	NEDD8
10	9606.ENSP00000258091	0.616	T-complex protein 1 subunit eta
11	9606.ENSP00000299300	0.615	T-complex protein 1 subunit beta
12	9606.ENSP00000286788	0.612	T-complex protein 1 subunit theta
13	9606.ENSP00000281623	0.611	F-box only protein 4
14	9606.ENSP00000280326	0.605	T-complex protein 1 subunit epsilon
15	9606.ENSP00000275603	0.600	T-complex protein 1 subunit zeta
16	9606.ENSP00000295688	0.600	T-complex protein 1 subunit gamma
17	9606.ENSP00000317334	0.600	T-complex protein 1 subunit alpha
18	9606.ENSP00000327191	0.600	T-complex protein 1 subunit zeta-2
19	9606.ENSP00000377958	0.600	T-complex protein 1 subunit delta
20	9606.ENSP00000262643	0.589	G1/S-specific cyclin-E1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.988	cellular process
GO:0050794	0.984	regulation of cellular process
GO:0008152	0.765	metabolic process
GO:0071704	0.740	organic substance metabolic process
GO:0044238	0.638	primary metabolic process
GO:0043170	0.612	macromolecule metabolic process
GO:0006807	0.605	nitrogen compound metabolic process
GO:0048518	0.538	positive regulation of biological process
GO:0019538	0.486	protein metabolic process
GO:0019222	0.421	regulation of metabolic process
GO:0044237	0.381	cellular metabolic process
GO:0060255	0.370	regulation of macromolecule metabolic process
GO:0048522	0.363	positive regulation of cellular process
GO:0006508	0.360	proteolysis
GO:0051128	0.333	regulation of cellular component organization
GO:0044260	0.300	cellular macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043226	0.925	organelle
GO:0043229	0.914	intracellular organelle
GO:0043227	0.909	membrane-bounded organelle
GO:0043231	0.800	intracellular membrane-bounded organelle
GO:0005634	0.749	nucleus
GO:0070013	0.460	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]