StarFunc result for job id Q5XXA6

User Input

>input (986 residues)
MRVNEKYSTLPAEDRSVHIINICAIEDIGYLPSEGTLLNSLSVDPDAECKYGLYFRDGRR
KVDYILVYHHKRPSGNRTLVRRVQHSDTPSGARSVKQDHPLPGKGASLDAGSGEPPMDYH
EDDKRFRREEYEGNLLEAGLELERDEDTKIHGVGFVKIHAPWNVLCREAEFLKLKMPTKK
MYHINETRGLLKKINSVLQKITDPIQPKVAEHRPQTMKRLSYPFSREKQHLFDLSDKDSF
FDSKTRSTIVYEILKRTTCTKAKYSMGITSLLANGVYAAAYPLHDGDYNGENVEFNDRKL
LYEEWARYGVFYKYQPIDLVRKYFGEKIGLYFAWLGVYTQMLIPASIVGIIVFLYGCATM
DENIPSMEMCDQRHNITMCPLCDKTCSYWKMSSACATARASHLFDNPATVFFSVFMALWA
ATFMEHWKRKQMRLNYRWDLTGFEEEEEAVKDHPRAEYEARVLEKSLKKESRNKEKRRHI
PEESTNKWKQRVKTAMAGVKLTDKVKLTWRDRFPAYLTNLVSIIFMIAVTFAIVLGVIIY
RISMAAALAMNSSPSVRSNIRVTVTATAVIINLVVIILLDEVYGCIARWLTKIEVPKTEK
SFEERLIFKAFLLKFVNSYTPIFYVAFFKGRFVGRPGDYVYIFRSFRMEECAPGGCLMEL
CIQLSIIMLGKQLIQNNLFEIGIPKMKKLIRYLKLKQQSPPDHEECVKRKQRYEVDYNLE
PFAGLTPEYMEMIIQFGFVTLFVASFPLAPLFALLNNIIEIRLDAKKFVTELRRPVAVRA
KDIGIWYNILRGIGKLAVIINAFVISFTSDFIPRLVYLYMYSKNGTMHGFVNHTLSSFNV
SDFQNGTAPNDPLDLGYEVQICRYKDYREPPWSENKYDISKDFWAVLAARLAFVIVFQNL
VMFMSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREEQDKQQLLETWMEKERQKDEPPC
NHHNTKACPDSLGSPAPSHAYHGGVL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D4A915	0.874	0.830	0.000	1040	0.888	0.842	D4A915.pdb.gz	D4A915_RAT Anoctamin OS=Rattus norvegicus OX=10116 GN=Ano1 PE=3 SV=1
2	AFDB:Q5XXA6	1.000	1.000	0.000	986	1.000	1.000	Q5XXA6.pdb.gz	ANO1_HUMAN Anoctamin-1 OS=Homo sapiens OX=9606 GN=ANO1 PE=1 SV=1
3	AFDB:Q8BHY3	0.864	0.887	0.000	960	0.894	0.918	Q8BHY3.pdb.gz	ANO1_MOUSE Anoctamin-1 OS=Mus musculus OX=10090 GN=Ano1 PE=1 SV=2
4	AFDB:Q9NQ90	0.836	0.822	4.595E-98	1003	0.582	0.572	Q9NQ90.pdb.gz	ANO2_HUMAN Anoctamin-2 OS=Homo sapiens OX=9606 GN=ANO2 PE=1 SV=2
5	PDB:7zk3A	0.680	0.925	8.272E-78	721	0.650	0.889	7zk3A.pdb.gz	Inhibition mechanism of the chloride channel TMEM16A by the pore blocker 1PBC.
6	PDB:7b5dA	0.655	0.911	1.913E-70	701	0.615	0.864	7b5dA.pdb.gz
7	AFDB:Q75V66	0.766	0.825	2.366E-66	913	0.363	0.392	Q75V66.pdb.gz	ANO5_HUMAN Anoctamin-5 OS=Homo sapiens OX=9606 GN=ANO5 PE=1 SV=1
8	AFDB:Q75UR0	0.771	0.838	6.866E-66	904	0.352	0.384	Q75UR0.pdb.gz	ANO5_MOUSE Anoctamin-5 OS=Mus musculus OX=10090 GN=Ano5 PE=2 SV=1
9	AFDB:A0A0B4JCY1	0.768	0.691	1.119E-65	1099	0.372	0.334	A0A0B4JCY1.pdb.gz	A0A0B4JCY1_DROME Anoctamin OS=Drosophila melanogaster OX=7227 GN=subdued PE=3 SV=1
10	AFDB:Q6P9J9	0.758	0.818	2.406E-63	911	0.351	0.380	Q6P9J9.pdb.gz	ANO6_MOUSE Anoctamin-6 OS=Mus musculus OX=10090 GN=Ano6 PE=1 SV=1
11	AFDB:F1QNZ8	0.756	0.817	4.683E-63	910	0.355	0.385	F1QNZ8.pdb.gz	F1QNZ8_DANRE Anoctamin OS=Danio rerio OX=7955 GN=ano6 PE=3 SV=1
12	AFDB:Q6IWH7	0.730	0.770	1.453E-58	933	0.339	0.358	Q6IWH7.pdb.gz	ANO7_HUMAN Anoctamin-7 OS=Homo sapiens OX=9606 GN=ANO7 PE=1 SV=2
13	PDB:8b8kA	0.683	0.904	3.790E-51	741	0.325	0.432	8b8kA.pdb.gz	Structural basis for the activation of the lipid scramblase TMEM16F.
14	PDB:8b8jA	0.635	0.873	1.176E-46	709	0.313	0.436	8b8jA.pdb.gz	Structural basis for the activation of the lipid scramblase TMEM16F.
15	PDB:8b8mB	0.622	0.891	7.019E-44	682	0.309	0.447	8b8mB.pdb.gz	Structural basis for the activation of the lipid scramblase TMEM16F.
16	PDB:8bc0B	0.589	0.900	6.790E-42	636	0.299	0.464	8bc0B.pdb.gz	Structural basis for the activation of the lipid scramblase TMEM16F.
17	PDB:6bgiA	0.439	0.812	4.238E-39	510	0.492	0.951	6bgiA.pdb.gz	Cryo-EM structures of the TMEM16A calcium-activated chloride channel.
18	PDB:6bgjA	0.413	0.784	4.076E-38	490	0.473	0.951	6bgjA.pdb.gz	Cryo-EM structures of the TMEM16A calcium-activated chloride channel.
19	PDB:6p47A	0.649	0.872	1.614E-37	725	0.313	0.426	6p47A.pdb.gz
20	PDB:8bc1A	0.501	0.928	1.047E-35	527	0.243	0.455	8bc1A.pdb.gz	Structural basis for the activation of the lipid scramblase TMEM16F.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0B4JCY1	630	1099	0.361	0.324	A0A0B4JCY1_DROME Anoctamin OS=Drosophila melanogaster OX=7227 GN=subdued PE=3 SV=1
2	A0A0B4KGH4	630	950	0.360	0.374	A0A0B4KGH4_DROME Anoctamin OS=Drosophila melanogaster OX=7227 GN=subdued PE=3 SV=1
3	A0A0G2JU76	1080	903	0.551	0.601	A0A0G2JU76_RAT Anoctamin OS=Rattus norvegicus OX=10116 GN=Ano2 PE=3 SV=2
4	A0A0G2JXB5	1152	1002	0.578	0.569	A0A0G2JXB5_RAT Anoctamin OS=Rattus norvegicus OX=10116 GN=Ano2 PE=3 SV=2
5	A0A0G2K052	1828	1039	0.899	0.853	A0A0G2K052_RAT Anoctamin OS=Rattus norvegicus OX=10116 GN=Ano1 PE=1 SV=2
6	A0A0G2K1M7	581	909	0.351	0.381	A0A0G2K1M7_RAT Anoctamin OS=Rattus norvegicus OX=10116 GN=Ano6 PE=1 SV=1
7	A0A8I5Y1S2	581	924	0.351	0.374	A0A8I5Y1S2_RAT Anoctamin OS=Rattus norvegicus OX=10116 GN=Ano6 PE=1 SV=1
8	A0A8I5ZNW7	1889	1040	0.917	0.869	A0A8I5ZNW7_RAT Anoctamin OS=Rattus norvegicus OX=10116 GN=Ano1 PE=1 SV=1
9	A0A8I5ZRU7	582	911	0.351	0.380	A0A8I5ZRU7_RAT Anoctamin OS=Rattus norvegicus OX=10116 GN=Ano6 PE=1 SV=1
10	A0A8I6AA94	582	932	0.351	0.371	A0A8I6AA94_RAT Anoctamin OS=Rattus norvegicus OX=10116 GN=Ano6 PE=1 SV=1
11	A0A8I6AHD2	581	865	0.354	0.403	A0A8I6AHD2_RAT Anoctamin OS=Rattus norvegicus OX=10116 GN=Ano6 PE=1 SV=1
12	A0A8I6ASC3	580	888	0.351	0.390	A0A8I6ASC3_RAT Anoctamin OS=Rattus norvegicus OX=10116 GN=Ano6 PE=1 SV=1
13	A0A8I6G530	580	887	0.351	0.390	A0A8I6G530_RAT Anoctamin OS=Rattus norvegicus OX=10116 GN=Ano6 PE=1 SV=1
14	A0A8I6GJA0	1100	911	0.556	0.602	A0A8I6GJA0_RAT Anoctamin OS=Rattus norvegicus OX=10116 GN=Ano2 PE=3 SV=1
15	A0A8I6GL36	1719	990	0.857	0.854	A0A8I6GL36_RAT Anoctamin OS=Rattus norvegicus OX=10116 GN=Ano1 PE=1 SV=1
16	A2AHL1	621	981	0.372	0.374	ANO3_MOUSE Anoctamin-3 OS=Mus musculus OX=10090 GN=Ano3 PE=1 SV=1
17	D4A915	1819	1040	0.895	0.848	D4A915_RAT Anoctamin OS=Rattus norvegicus OX=10116 GN=Ano1 PE=3 SV=1
18	F1M0A0	620	981	0.370	0.372	F1M0A0_RAT Anoctamin OS=Rattus norvegicus OX=10116 GN=Ano3 PE=3 SV=4
19	F1M3G8	1146	936	0.574	0.605	F1M3G8_RAT Anoctamin OS=Rattus norvegicus OX=10116 GN=Ano2 PE=3 SV=3
20	F1QNZ8	571	910	0.357	0.387	F1QNZ8_DANRE Anoctamin OS=Danio rerio OX=7955 GN=ano6 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04547 Anoctamin	9e-154	524.4	Calcium-activated chloride channel
2	PF16178 Anoct_dimer	2.8e-84	293.9	Dimerisation domain of Ca+-activated chloride-channel, anoctamin
3	PF09972 DUF2207	4	17.8	Predicted membrane protein (DUF2207)
4	PF07069 PRRSV_2b	6.6e+02	12.2	Porcine reproductive and respiratory syndrome virus 2b

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000347454

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000356042	0.979	Ezrin
2	9606.ENSP00000461007	0.978	Transient receptor potential cation channel subfamily V member 1
3	9606.ENSP00000003084	0.914	Cystic fibrosis transmembrane conductance regulator
4	9606.ENSP00000448310	0.898	Bestrophin-2
5	9606.ENSP00000332413	0.881	Bestrophin-3
6	9606.ENSP00000361281	0.880	Bestrophin-4
7	9606.ENSP00000399709	0.852	Bestrophin-1
8	9606.ENSP00000288135	0.840	Mast/stem cell growth factor receptor Kit
9	9606.ENSP00000406191	0.840	Transient receptor potential cation channel subfamily V member 4
10	9606.ENSP00000275493	0.785	Epidermal growth factor receptor
11	9606.ENSP00000459962	0.775	Transient receptor potential cation channel, subfamily V, member 1
12	9606.ENSP00000353332	0.771	Regulator of telomere elongation helicase 1
13	9606.ENSP00000310036	0.755	Hematopoietic progenitor cell antigen CD34
14	9606.ENSP00000257290	0.735	Platelet-derived growth factor receptor alpha
15	9606.ENSP00000378920	0.728	Solute carrier family 26 member 6
16	9606.ENSP00000265593	0.727	Chloride channel protein 2
17	9606.ENSP00000339867	0.724	Chloride channel protein 1
18	9606.ENSP00000384136	0.724	Radixin
19	9606.ENSP00000269346	0.722	Protein tweety homolog 2
20	9606.ENSP00000259008	0.721	Fanconi anemia group J protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0005229	0.998	intracellular calcium activated chloride channel activity
GO:0022839	0.962	monoatomic ion gated channel activity
GO:0042802	0.882	identical protein binding
GO:0005227	0.807	calcium activated cation channel activity
GO:0008308	0.410	voltage-gated monoatomic anion channel activity
GO:0005247	0.401	voltage-gated chloride channel activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.994	cellular process
GO:0051179	0.978	localization
GO:0006811	0.973	monoatomic ion transport
GO:0034220	0.947	monoatomic ion transmembrane transport
GO:0006821	0.942	chloride transport
GO:0098660	0.908	inorganic ion transmembrane transport
GO:0050896	0.832	response to stimulus
GO:0065007	0.814	biological regulation
GO:0098661	0.801	inorganic anion transmembrane transport
GO:0098656	0.799	monoatomic anion transmembrane transport
GO:1902476	0.793	chloride transmembrane transport
GO:0050789	0.739	regulation of biological process
GO:0050794	0.668	regulation of cellular process
GO:0051716	0.632	cellular response to stimulus
GO:0048518	0.422	positive regulation of biological process
GO:0048522	0.348	positive regulation of cellular process
GO:0032501	0.327	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0043226	0.748	organelle
GO:0043227	0.735	membrane-bounded organelle
GO:0005622	0.614	intracellular anatomical structure
GO:0043231	0.505	intracellular membrane-bounded organelle
GO:0005737	0.366	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29823	0.998	chloride(in) = chloride(out)

[back to server]