StarFunc result for job id Q5ZPR3

User Input

>input (534 residues)
MLRRRGSPGMGVHVGAALGALWFCLTGALEVQVPEDPVVALVGTDATLCCSFSPEPGFSL
AQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSF
TCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYQGYPEAEVFWQD
GQGVPLTGNVTTSQMANEQGLFDVHSILRVVLGANGTYSCLVRNPVLQQDAHSSVTITPQ
RSPTGAVEVQVPEDPVVALVGTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEG
RDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPY
SKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLF
DVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFPPEALWVTVGLSVCLIAL
LVALAFVCWRKIKQSCEEENAGAEDQDGEGEGSKTALQPLKHSDSKEDDGQEIA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5ZPR3	1.000	1.000	1.873E-91	534	1.000	1.000	Q5ZPR3.pdb.gz	CD276_HUMAN CD276 antigen OS=Homo sapiens OX=9606 GN=CD276 PE=1 SV=1
2	AFDB:Q8VE98	0.421	0.698	3.063E-42	316	0.506	0.854	Q8VE98.pdb.gz	CD276_MOUSE CD276 antigen OS=Mus musculus OX=10090 GN=Cd276 PE=1 SV=1
3	AFDB:Q9UIR0	0.364	0.424	1.041E-30	455	0.212	0.248	Q9UIR0.pdb.gz	BTNL2_HUMAN Butyrophilin-like protein 2 OS=Homo sapiens OX=9606 GN=BTNL2 PE=1 SV=1
4	AFDB:O70355	0.376	0.435	4.745E-30	454	0.217	0.256	O70355.pdb.gz	BTNL2_MOUSE Butyrophilin-like protein 2 OS=Mus musculus OX=10090 GN=Btnl2 PE=1 SV=2
5	AFDB:Q9EPF2	0.292	0.243	5.451E-21	648	0.213	0.176	Q9EPF2.pdb.gz	MUC18_RAT Cell surface glycoprotein MUC18 OS=Rattus norvegicus OX=10116 GN=Mcam PE=1 SV=2
6	AFDB:B3DH03	0.279	0.245	1.164E-20	617	0.191	0.165	B3DH03.pdb.gz
7	AFDB:P31809	0.329	0.336	1.220E-20	521	0.193	0.198	P31809.pdb.gz	CEAM1_MOUSE Carcinoembryonic antigen-related cell adhesion molecule 1 OS=Mus musculus OX=10090 GN=Ceacam1 PE=1 SV=1
8	AFDB:Q9UM44	0.328	0.416	2.156E-20	414	0.182	0.234	Q9UM44.pdb.gz	HHLA2_HUMAN HERV-H LTR-associating protein 2 OS=Homo sapiens OX=9606 GN=HHLA2 PE=1 SV=1
9	AFDB:Q13740	0.341	0.315	2.606E-20	583	0.182	0.166	Q13740.pdb.gz	CD166_HUMAN CD166 antigen OS=Homo sapiens OX=9606 GN=ALCAM PE=1 SV=2
10	AFDB:Q90880	0.332	0.287	2.733E-20	626	0.197	0.168	Q90880.pdb.gz	Q90880_CHICK L-gicerin OS=Gallus gallus OX=9031 PE=2 SV=1
11	PDB:1igaA	0.174	0.193	7.373E-15	475	0.189	0.213	1igaA.pdb.gz
12	PDB:1hzhH	0.204	0.227	7.731E-15	457	0.169	0.197	1hzhH.pdb.gz	Crystal structure of a neutralizing human IGG against HIV-1: a template for vaccine design.
13	PDB:1e07A	0.244	0.211	3.362E-14	642	0.144	0.120	1e07A.pdb.gz
14	PDB:2rcjC	0.195	0.198	9.540E-14	523	0.172	0.176	2rcjC.pdb.gz
15	PDB:5oj2B	0.227	0.184	1.153E-13	692	0.133	0.103	5oj2B.pdb.gz
16	PDB:1igtB	0.191	0.222	1.767E-13	444	0.140	0.169	1igtB.pdb.gz	Refined structure of an intact IgG2a monoclonal antibody.
17	PDB:1zvoC	0.166	0.172	8.625E-12	512	0.170	0.178	1zvoC.pdb.gz
18	PDB:5a42A	0.145	0.062	1.227E-10	1597	0.135	0.045	5a42A.pdb.gz
19	PDB:4ziqA	0.156	0.084	2.273E-10	1450	0.133	0.049	4ziqA.pdb.gz
20	PDB:3o3uN	0.320	0.297	8.573E-10	580	0.084	0.078	3o3uN.pdb.gz	The 1.5 A crystal structure of human receptor for advanced glycation endproducts (RAGE) ectodomains reveals unique features determining ligand binding.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5ZPR3	0.0	1096	534	1.000	1.000	CD276_HUMAN CD276 antigen OS=Homo sapiens OX=9606 GN=CD276 PE=1 SV=1
2	Q8VE98	0.0	529	316	0.506	0.854	CD276_MOUSE CD276 antigen OS=Mus musculus OX=10090 GN=Cd276 PE=1 SV=1
3	Q9UIR0	3.15e-40	153	455	0.225	0.264	BTNL2_HUMAN Butyrophilin-like protein 2 OS=Homo sapiens OX=9606 GN=BTNL2 PE=1 SV=1
4	O70355	3.47e-33	133	454	0.212	0.249	BTNL2_MOUSE Butyrophilin-like protein 2 OS=Mus musculus OX=10090 GN=Btnl2 PE=1 SV=2
5	Q9NZQ7	9.13e-32	126	290	0.157	0.290	PD1L1_HUMAN Programmed cell death 1 ligand 1 OS=Homo sapiens OX=9606 GN=CD274 PE=1 SV=1
6	D4AE25	5.57e-26	109	290	0.146	0.269	D4AE25_RAT CD274 molecule OS=Rattus norvegicus OX=10116 GN=Cd274 PE=4 SV=2
7	Q9EP73	2.30e-25	108	290	0.140	0.259	PD1L1_MOUSE Programmed cell death 1 ligand 1 OS=Mus musculus OX=10090 GN=Cd274 PE=1 SV=1
8	Q4QTK1	3.23e-25	107	287	0.125	0.233	Q4QTK1_PIG CD274 molecule OS=Sus scrofa OX=9823 GN=CD274 PE=2 SV=1
9	Q62556	1.63e-23	106	524	0.157	0.160	BT1A1_MOUSE Butyrophilin subfamily 1 member A1 OS=Mus musculus OX=10090 GN=Btn1a1 PE=1 SV=2
10	Q13410	4.86e-22	101	526	0.142	0.144	BT1A1_HUMAN Butyrophilin subfamily 1 member A1 OS=Homo sapiens OX=9606 GN=BTN1A1 PE=1 SV=3
11	Q7TSP5	2.48e-21	96.3	283	0.131	0.247	VTCN1_MOUSE V-set domain containing T-cell activation inhibitor 1 OS=Mus musculus OX=10090 GN=Vtcn1 PE=1 SV=1
12	Q7Z7D3	5.13e-20	92.4	282	0.122	0.230	VTCN1_HUMAN V-set domain-containing T-cell activation inhibitor 1 OS=Homo sapiens OX=9606 GN=VTCN1 PE=1 SV=1
13	A0N0L8	1.49e-19	91.7	302	0.137	0.242	A0N0L8_HUMAN Inducible T-cell co-stimulator ligand OS=Homo sapiens OX=9606 GN=ICOSLG PE=2 SV=1
14	O75144	1.49e-19	91.7	302	0.137	0.242	ICOSL_HUMAN ICOS ligand OS=Homo sapiens OX=9606 GN=ICOSLG PE=1 SV=2
15	P78410	1.82e-19	92.0	334	0.120	0.192	BT3A2_HUMAN Butyrophilin subfamily 3 member A2 OS=Homo sapiens OX=9606 GN=BTN3A2 PE=1 SV=2
16	O00478	3.16e-19	93.2	584	0.140	0.128	BT3A3_HUMAN Butyrophilin subfamily 3 member A3 OS=Homo sapiens OX=9606 GN=BTN3A3 PE=1 SV=1
17	K4DIA0	1.36e-18	90.9	473	0.137	0.154	K4DIA0_HUMAN Inducible T cell costimulator ligand OS=Homo sapiens OX=9606 GN=ICOSLG PE=1 SV=1
18	Q9JHJ8	3.24e-18	87.8	322	0.125	0.208	ICOSL_MOUSE ICOS ligand OS=Mus musculus OX=10090 GN=Icoslg PE=1 SV=1
19	M0RD77	4.99e-18	87.4	313	0.146	0.249	M0RD77_RAT Butyrophilin-like 8 OS=Rattus norvegicus OX=10116 GN=Btnl8 PE=4 SV=1
20	Q7KYR7	6.09e-18	89.0	527	0.140	0.142	BT2A1_HUMAN Butyrophilin subfamily 2 member A1 OS=Homo sapiens OX=9606 GN=BTN2A1 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07703 A2M_BRD	4.1e+02	12.7	Alpha-2-macroglobulin bait region domain
2	PF07654 C1-set	3.6e-09	48.2	Immunoglobulin C1-set domain
3	PF08205 C2-set_2	5.7e-16	69.7	CD80-like C2-set immunoglobulin domain
4	PF07235 DUF1427	1.9e+02	13.4	Protein of unknown function (DUF1427)
5	PF09378 HAS-barrel	68	15.0	HAS barrel domain
6	PF07679 I-set	9.6e-17	72.2	Immunoglobulin I-set domain
7	PF00047 ig	6.9e-29	111.2	Immunoglobulin domain
8	PF13895 Ig_2	1.2e-16	72.1	Immunoglobulin domain
9	PF13927 Ig_3	2.1e-30	116.4	Immunoglobulin domain
10	PF18452 Ig_6	3.9e+02	12.3	Immunoglobulin domain
11	PF07686 V-set	2.8e-18	77.5	Immunoglobulin V-set domain
12	PF17794 Vault_2	1e+02	14.8	Major Vault Protein repeat domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000320084

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000303939	0.989	Cytotoxic T-lymphocyte protein 4
2	9606.ENSP00000418767	0.988	Trem-like transcript 2 protein
3	9606.ENSP00000324890	0.970	T-cell-specific surface glycoprotein CD28
4	9606.ENSP00000361359	0.952	Tumor necrosis factor receptor superfamily member 5
5	9606.ENSP00000359663	0.925	CD40 ligand
6	9606.ENSP00000347948	0.870	Tumor necrosis factor receptor superfamily member 14
7	9606.ENSP00000245817	0.864	Tumor necrosis factor ligand superfamily member 9
8	9606.ENSP00000245903	0.857	CD70 antigen
9	9606.ENSP00000478699	0.833	Tumor necrosis factor receptor superfamily member 9
10	9606.ENSP00000011653	0.832	T-cell surface glycoprotein CD4
11	9606.ENSP00000386559	0.806	T-cell surface glycoprotein CD8 alpha chain
12	9606.ENSP00000231449	0.762	Interleukin-4
13	9606.ENSP00000281834	0.743	Tumor necrosis factor ligand superfamily member 4
14	9606.ENSP00000412237	0.741	Interleukin-10
15	9606.ENSP00000368538	0.739	Tumor necrosis factor receptor superfamily member 4
16	9606.ENSP00000226730	0.735	Interleukin-2
17	9606.ENSP00000398698	0.732	Tumor necrosis factor
18	9606.ENSP00000229135	0.717	Interferon gamma
19	9606.ENSP00000356946	0.711	Low affinity immunoglobulin gamma Fc region receptor III-A
20	9606.ENSP00000266557	0.710	CD27 antigen

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005102	0.551	signaling receptor binding
GO:0042802	0.301	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0048518	0.995	positive regulation of biological process
GO:0051239	0.992	regulation of multicellular organismal process
GO:0009987	0.990	cellular process
GO:0060255	0.989	regulation of macromolecule metabolic process
GO:0002682	0.988	regulation of immune system process
GO:0042127	0.979	regulation of cell population proliferation
GO:0048522	0.979	positive regulation of cellular process
GO:0032501	0.976	multicellular organismal process
GO:0030155	0.975	regulation of cell adhesion
GO:0010468	0.973	regulation of gene expression
GO:0032944	0.959	regulation of mononuclear cell proliferation
GO:1903037	0.948	regulation of leukocyte cell-cell adhesion
GO:0050863	0.939	regulation of T cell activation
GO:0002684	0.932	positive regulation of immune system process
GO:0045785	0.931	positive regulation of cell adhesion
GO:0050670	0.930	regulation of lymphocyte proliferation
GO:0045321	0.922	leukocyte activation
GO:0002696	0.915	positive regulation of leukocyte activation
GO:0001817	0.911	regulation of cytokine production
GO:0022409	0.908	positive regulation of cell-cell adhesion
GO:0042129	0.904	regulation of T cell proliferation
GO:0001819	0.902	positive regulation of cytokine production
GO:0051251	0.888	positive regulation of lymphocyte activation
GO:0050896	0.881	response to stimulus
GO:0046649	0.875	lymphocyte activation
GO:0050870	0.871	positive regulation of T cell activation
GO:0042110	0.870	T cell activation
GO:0008284	0.865	positive regulation of cell population proliferation
GO:0070665	0.860	positive regulation of leukocyte proliferation
GO:0032946	0.826	positive regulation of mononuclear cell proliferation
GO:0050671	0.782	positive regulation of lymphocyte proliferation
GO:0042102	0.736	positive regulation of T cell proliferation
GO:0032649	0.711	regulation of type II interferon production
GO:0051716	0.588	cellular response to stimulus
GO:0048583	0.549	regulation of response to stimulus
GO:0048519	0.498	negative regulation of biological process
GO:0048523	0.415	negative regulation of cellular process
GO:0007154	0.334	cell communication

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0043226	0.744	organelle
GO:0009986	0.729	cell surface
GO:0005737	0.710	cytoplasm
GO:0043229	0.702	intracellular organelle
GO:0043227	0.694	membrane-bounded organelle
GO:0032991	0.575	protein-containing complex
GO:0005576	0.529	extracellular region
GO:0005615	0.479	extracellular space
GO:0031982	0.459	vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]