StarFunc result for job id Q63HK5

User Input

>input (1081 residues)
MPRRKQQAPRRAAAYVSEELKAAALVDEGLDPEEHTADGEPSAKYMCPEKELARACPSYQ
NSPAAEFSCHEMDSESHISETSDRMADFESGSIKNEEETKEVTVPLEDTTVSDSLEQMKA
VYNNFLSNSYWSNLNLNLHQPSSEKNNGSSSSSSSSSSSCGSGSFDWHQSAMAKTLQQVS
QSRMLPEPSLFSTVQLYRQSSKLYGSIFTGASKFRCKDCSAAYDTLVELTVHMNETGHYR
DDNHETDNNNPKRWSKPRKRSLLEMEGKEDAQKVLKCMYCGHSFESLQDLSVHMIKTKHY
QKVPLKEPVTPVAAKIIPATRKKASLELELPSSPDSTGGTPKATISDTNDALQKNSNPYI
TPNNRYGHQNGASYAWHFEARKSQILKCMECGSSHDTLQELTAHMMVTGHFIKVTNSAMK
KGKPIVETPVTPTITTLLDEKVQSVPLAATTFTSPSNTPASISPKLNVEVKKEVDKEKAV
TDEKPKQKDKPGEEEEKCDISSKYHYLTENDLEESPKGGLDILKSLENTVTSAINKAQNG
TPSWGGYPSIHAAYQLPNMMKLSLGSSGKSTPLKPMFGNSEIVSPTKNQTLVSPPSSQTS
PMPKTNFHAMEELVKKVTEKVAKVEEKMKEPDGKLSPPKRATPSPCSSEVGEPIKMEASS
DGGFRSQENSPSPPRDGCKDGSPLAEPVENGKELVKPLASSLSGSTAIITDHPPEQPFVN
PLSALQSVMNIHLGKAAKPSLPALDPMSMLFKMSNSLAEKAAVATPPPLQSKKADHLDRY
FYHVNNDQPIDLTKGKSDKGCSLGSVLLSPTSTAPATSSSTVTTAKTSAVVSFMSNSPLR
ENALSDISDMLKNLTESHTSKSSTPSSISEKSDIDGATLEEAEESTPAQKRKGRQSNWNP
QHLLILQAQFAASLRQTSEGKYIMSDLSPQERMHISRFTGLSMTTISHWLANVKYQLRRT
GGTKFLKNLDTGHPVFFCNDCASQIRTPSTYISHLESHLGFRLRDLSKLSTEQINSQIAQ
TKSPSEKMVTSSPEEDLGTSYQCKLCNRTFASKHAVKLHLSKTHGKSPEDHLLYVSELEK
Q

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q63HK5	1.000	1.000	0.000	1081	1.000	1.000	Q63HK5.pdb.gz	TSH3_HUMAN Teashirt homolog 3 OS=Homo sapiens OX=9606 GN=TSHZ3 PE=1 SV=2
2	AFDB:Q9NRE2	0.166	0.172	1.144E-74	1034	0.469	0.490	Q9NRE2.pdb.gz	TSH2_HUMAN Teashirt homolog 2 OS=Homo sapiens OX=9606 GN=TSHZ2 PE=1 SV=3
3	AFDB:F1QV43	0.177	0.185	5.206E-73	1020	0.459	0.486	F1QV43.pdb.gz	F1QV43_DANRE Teashirt homolog 2 isoform X2 OS=Danio rerio OX=7955 GN=tshz2 PE=3 SV=3
4	AFDB:P37275	0.056	0.055	5.403E-6	1124	0.147	0.141	P37275.pdb.gz	ZEB1_HUMAN Zinc finger E-box-binding homeobox 1 OS=Homo sapiens OX=9606 GN=ZEB1 PE=1 SV=2
5	AFDB:Q17R98	0.055	0.055	9.810E-6	1081	0.144	0.144	Q17R98.pdb.gz	ZN827_HUMAN Zinc finger protein 827 OS=Homo sapiens OX=9606 GN=ZNF827 PE=1 SV=1
6	AFDB:A2A7B5	0.055	0.041	1.354E-4	1709	0.157	0.099	A2A7B5.pdb.gz	A2A7B5_MOUSE PR domain containing 2, with ZNF domain OS=Mus musculus OX=10090 GN=Prdm2 PE=1 SV=1
7	AFDB:F1QQA8	0.050	0.049	2.315E-4	1095	0.145	0.143	F1QQA8.pdb.gz	ZN219_DANRE Zinc finger protein 219 OS=Danio rerio OX=7955 GN=znf219 PE=1 SV=2
8	AFDB:Q13029	0.055	0.040	5.028E-4	1718	0.159	0.100	Q13029.pdb.gz	PRDM2_HUMAN PR domain zinc finger protein 2 OS=Homo sapiens OX=9606 GN=PRDM2 PE=1 SV=3
9	AFDB:A0A1W2PQA1	0.066	0.067	1.599E-2	1069	0.157	0.159	A0A1W2PQA1.pdb.gz	A0A1W2PQA1_HUMAN RE1 silencing transcription factor OS=Homo sapiens OX=9606 GN=REST PE=1 SV=2
10	AFDB:A0A0R4INF0	0.054	0.040	3.472E-2	1570	0.153	0.105	A0A0R4INF0.pdb.gz	A0A0R4INF0_DANRE Zinc finger and BTB domain-containing 4 OS=Danio rerio OX=7955 GN=zbtb4 PE=4 SV=1
11	PDB:5y6lB	0.040	0.172	5.689E-1	173	0.015	0.092	5y6lB.pdb.gz
12	PDB:6fyxm	0.040	0.146	6.804E-1	147	0.009	0.068	6fyxm.pdb.gz	Translational initiation factor eIF5 replaces eIF1 on the 40S ribosomal subunit to promote start-codon recognition.
13	PDB:4btsA9	0.033	0.152	7.223E-1	93	0.015	0.172	4btsA9.pdb.gz	The crystal structure of the eukaryotic 40S ribosomal subunit in complex with eIF1 and eIF1A.
14	PDB:4zzlA	0.045	0.175	7.666E-1	146	0.019	0.137	4zzlA.pdb.gz
15	PDB:1k92A	0.037	0.071	1.991	444	0.018	0.043	1k92A.pdb.gz
16	PDB:6hixBN	0.048	0.165	1.991	214	0.019	0.098	6hixBN.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
17	PDB:2cyyA	0.038	0.214	2.243	151	0.016	0.113	2cyyA.pdb.gz	Crystal structure of PH1519 from Pyrococcus horikosii OT3
18	PDB:7fbyA	0.048	0.246	2.528	153	0.012	0.085	7fbyA.pdb.gz	Crystal Structure of PH0140 from Pyrococcus horikosii OT3
19	PDB:3oe6A	0.037	0.077	3.023	418	0.010	0.026	3oe6A.pdb.gz	Structures of the CXCR4 chemokine GPCR with small-molecule and cyclic peptide antagonists.
20	PDB:2kr0A	0.048	0.092	3.406	407	0.049	0.130	2kr0A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0SNQ7	0.0	1722	1004	0.813	0.875	A0SNQ7_XENLA Teashirt zinc finger homeobox 3 L homeolog OS=Xenopus laevis OX=8355 GN=tshz3.L PE=1 SV=1
2	D3ZKB9	0.0	1960	1072	0.936	0.944	TSH3_RAT Teashirt homolog 3 OS=Rattus norvegicus OX=10116 GN=Tshz3 PE=1 SV=2
3	F1QV43	0.0	852	1020	0.488	0.518	F1QV43_DANRE Teashirt homolog 2 isoform X2 OS=Danio rerio OX=7955 GN=tshz2 PE=3 SV=3
4	Q5DTH5	0.0	1127	1084	0.585	0.583	TSH1_MOUSE Teashirt homolog 1 OS=Mus musculus OX=10090 GN=Tshz1 PE=1 SV=2
5	Q63HK5	0.0	2232	1081	1.000	1.000	TSH3_HUMAN Teashirt homolog 3 OS=Homo sapiens OX=9606 GN=TSHZ3 PE=1 SV=2
6	Q68FE9	0.0	848	1030	0.475	0.499	TSH2_MOUSE Teashirt homolog 2 OS=Mus musculus OX=10090 GN=Tshz2 PE=1 SV=1
7	Q6ZSZ6	0.0	1127	1077	0.577	0.579	TSH1_HUMAN Teashirt homolog 1 OS=Homo sapiens OX=9606 GN=TSHZ1 PE=1 SV=2
8	Q8CGV9	0.0	2001	1081	0.952	0.952	TSH3_MOUSE Teashirt homolog 3 OS=Mus musculus OX=10090 GN=Tshz3 PE=1 SV=2
9	Q9NRE2	0.0	866	1034	0.493	0.515	TSH2_HUMAN Teashirt homolog 2 OS=Homo sapiens OX=9606 GN=TSHZ2 PE=1 SV=3
10	Q9U3V5	8.41e-07	55.8	1024	0.043	0.045	TIPT_DROME Protein tiptop OS=Drosophila melanogaster OX=7227 GN=tio PE=2 SV=2
11	P22265	1.48e-06	55.1	954	0.035	0.040	TSH_DROME Protein teashirt OS=Drosophila melanogaster OX=7227 GN=tsh PE=1 SV=2
12	J3KTI4	0.008	42.7	1091	0.029	0.028	J3KTI4_HUMAN Zinc finger protein 521 OS=Homo sapiens OX=9606 GN=ZNF521 PE=1 SV=1
13	Q96K83	0.011	42.4	1311	0.029	0.024	ZN521_HUMAN Zinc finger protein 521 OS=Homo sapiens OX=9606 GN=ZNF521 PE=1 SV=1
14	Q05516	0.012	42.0	673	0.030	0.048	ZBT16_HUMAN Zinc finger and BTB domain-containing protein 16 OS=Homo sapiens OX=9606 GN=ZBTB16 PE=1 SV=2
15	Q3UQ17	0.013	42.0	673	0.030	0.048	Q3UQ17_MOUSE Zinc finger and BTB domain containing 16 OS=Mus musculus OX=10090 GN=Zbtb16 PE=1 SV=1
16	Q5S3S9	0.013	42.0	673	0.030	0.048	Q5S3S9_RAT Promyelocytic leukemia zinc finger protein OS=Rattus norvegicus OX=10116 GN=Zbtb16 PE=1 SV=1
17	A3KMN0	0.014	42.0	651	0.030	0.049	A3KMN0_MOUSE Zbtb16 protein (Fragment) OS=Mus musculus OX=10090 GN=Zbtb16 PE=2 SV=1
18	Q6KAS7	0.015	42.0	1311	0.025	0.021	ZN521_MOUSE Zinc finger protein 521 OS=Mus musculus OX=10090 GN=Znf521 PE=1 SV=2
19	E9PYI1	0.030	40.8	671	0.044	0.072	ZN568_MOUSE Zinc finger protein 568 OS=Mus musculus OX=10090 GN=Znf568 PE=1 SV=1
20	P08970	0.041	40.4	941	0.027	0.031	SUHW_DROME Protein suppressor of hairy wing OS=Drosophila melanogaster OX=7227 GN=su(Hw) PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05077 DUF678	1.5e+02	14.0	Protein of unknown function (DUF678)
2	PF00046 Homeodomain	5.6e+02	11.8	Homeodomain
3	PF02748 PyrI_C	3.9e+02	12.3	Aspartate carbamoyltransferase regulatory chain, metal binding domain
4	PF08274 YjdM_Zn_Ribbon	2.1e+02	13.2	PhnA Zinc-Ribbon
5	PF00096 zf-C2H2	6.3e-06	37.5	Zinc finger, C2H2 type
6	PF12756 zf-C2H2_2	2.5e-06	39.1	C2H2 type zinc-finger (2 copies)
7	PF18868 zf-C2H2_3rep	6.7	18.9	Zinc finger C2H2-type, 3 repeats
8	PF13894 zf-C2H2_4	5.1e-05	34.8	C2H2-type zinc finger
9	PF13912 zf-C2H2_6	0.04	25.2	C2H2-type zinc finger
10	PF12171 zf-C2H2_jaz	5.1e+02	12.4	Zinc-finger double-stranded RNA-binding
11	PF16278 zf-C2HE	0.55	22.1	C2HE / C2H2 / C2HC zinc-binding finger
12	PF13465 zf-H2C2_2	5.6e+02	12.4	Zinc-finger double domain
13	PF12874 zf-met	2	20.1	Zinc-finger of C2H2 type
14	PF09723 Zn-ribbon_8	2.8e+02	13.1	Zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000240587

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000323967	0.784	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1
2	9606.ENSP00000358451	0.689	Ganglioside induced differentiation associated protein 2
3	9606.ENSP00000351539	0.672	Zinc finger and BTB domain-containing protein 18
4	9606.ENSP00000245479	0.670	Transcription factor SOX-9
5	9606.ENSP00000361602	0.663	Zinc finger protein 503
6	9606.ENSP00000441235	0.633	Thyrotropin receptor
7	9606.ENSP00000312277	0.622	Zinc finger protein 507
8	9606.ENSP00000477213	0.612	Amyloid-beta A4 precursor protein-binding family B member 1
9	9606.ENSP00000481994	0.588	Ephrin type-B receptor 6
10	9606.ENSP00000265361	0.581	Semaphorin-3C
11	9606.ENSP00000294954	0.540	Lutropin-choriogonadotropic hormone receptor
12	9606.ENSP00000398273	0.537	Transcription factor SOX-5
13	9606.ENSP00000417003	0.527	Involved in skeletal muscle differentiation. May act as a scaffold protein for AKT1 during muscle differentiation.

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003682	0.567	chromatin binding
GO:1901363	0.356	heterocyclic compound binding
GO:0097159	0.355	organic cyclic compound binding
GO:0003676	0.352	nucleic acid binding
GO:0043565	0.314	sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.990	regulation of cellular process
GO:0060255	0.966	regulation of macromolecule metabolic process
GO:0010468	0.959	regulation of gene expression
GO:0048519	0.866	negative regulation of biological process
GO:0051171	0.832	regulation of nitrogen compound metabolic process
GO:0080090	0.828	regulation of primary metabolic process
GO:0031323	0.816	regulation of cellular metabolic process
GO:0009889	0.795	regulation of biosynthetic process
GO:0009987	0.743	cellular process
GO:0032502	0.709	developmental process
GO:0048856	0.703	anatomical structure development
GO:0009892	0.703	negative regulation of metabolic process
GO:0031326	0.701	regulation of cellular biosynthetic process
GO:0048523	0.700	negative regulation of cellular process
GO:0010556	0.700	regulation of macromolecule biosynthetic process
GO:0019219	0.699	regulation of nucleobase-containing compound metabolic process
GO:0032501	0.696	multicellular organismal process
GO:0006355	0.670	regulation of DNA-templated transcription
GO:0010605	0.658	negative regulation of macromolecule metabolic process
GO:0045934	0.578	negative regulation of nucleobase-containing compound metabolic process
GO:0051253	0.568	negative regulation of RNA metabolic process
GO:0007275	0.561	multicellular organism development
GO:1902679	0.556	negative regulation of RNA biosynthetic process
GO:0045892	0.547	negative regulation of DNA-templated transcription
GO:0048513	0.515	animal organ development
GO:0009653	0.397	anatomical structure morphogenesis
GO:0006357	0.383	regulation of transcription by RNA polymerase II
GO:0048518	0.382	positive regulation of biological process
GO:0048522	0.346	positive regulation of cellular process
GO:0048731	0.322	system development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0016020	0.996	membrane
GO:0005886	0.990	plasma membrane
GO:0005737	0.978	cytoplasm
GO:0005829	0.538	cytosol
GO:0005739	0.402	mitochondrion
GO:0120025	0.350	plasma membrane bounded cell projection
GO:0012505	0.317	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]