StarFunc result for job id Q63HM1

User Input

>input (303 residues)
MMDVSGVGFPSKVPWKKMSAEELENQYCPSRWVVRLGAEEALRTYSQIGIEATTRARATR
KSLLHVPYGDGEGEKVDIYFPDESSEALPFFLFFHGGYWQSGSKDESAFMVHPLTAQGVA
VVIVAYGIAPKGTLDHMVDQVTRSVAFVQKRYPSNKGIYLCGHSAGAHLAAMMLLADWTK
HGVTPNLRGFFLVSGVFDLEPIVYTSQNVALQLTLEDAQRNSPQLKVAQAQPVDPTCRVL
VVVGQFDSPEFHRQSWEFYQTLCQGEWKASFEELHDVDHFEIVENLTQKDNVLTQIILKT
IFQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q63HM1	1.000	1.000	3.700E-65	303	1.000	1.000	Q63HM1.pdb.gz	KFA_HUMAN Kynurenine formamidase OS=Homo sapiens OX=9606 GN=AFMID PE=1 SV=2
2	AFDB:Q8K4H1	0.966	0.960	4.492E-50	305	0.690	0.685	Q8K4H1.pdb.gz	KFA_MOUSE Kynurenine formamidase OS=Mus musculus OX=10090 GN=Afmid PE=1 SV=1
3	AFDB:Q9VMC9	0.832	0.840	6.053E-26	300	0.234	0.237	Q9VMC9.pdb.gz	KFA_DROME Kynurenine formamidase OS=Drosophila melanogaster OX=7227 GN=KFase PE=1 SV=1
4	PDB:4e15B	0.825	0.825	8.324E-25	303	0.234	0.234	4e15B.pdb.gz
5	AFDB:G4REC9	0.714	0.771	2.078E-17	279	0.224	0.244	G4REC9.pdb.gz	G4REC9_PELHB Esterase OS=Pelagibacterium halotolerans (strain DSM 22347 / JCM 15775 / CGMCC 1.7692 / B2) OX=1082931 GN=KKY_2869 PE=4 SV=1
6	AFDB:Q8VYP9	0.672	0.441	5.011E-17	476	0.215	0.137	Q8VYP9.pdb.gz	ICML1_ARATH Probable isoprenylcysteine alpha-carbonyl methylesterase ICMEL1 OS=Arabidopsis thaliana OX=3702 GN=ICMEL1 PE=2 SV=1
7	AFDB:Q1PET6	0.742	0.543	9.555E-17	422	0.201	0.145	Q1PET6.pdb.gz	ICML2_ARATH Probable isoprenylcysteine alpha-carbonyl methylesterase ICMEL2 OS=Arabidopsis thaliana OX=3702 GN=ICMEL2 PE=2 SV=1
8	AFDB:Q94AS5	0.738	0.535	9.555E-17	427	0.218	0.155	Q94AS5.pdb.gz	ICME_ARATH Isoprenylcysteine alpha-carbonyl methylesterase ICME OS=Arabidopsis thaliana OX=3702 GN=ICME PE=1 SV=1
9	AFDB:P96402	0.633	0.488	4.329E-15	403	0.211	0.159	P96402.pdb.gz	LIPC_MYCTU Esterase LipC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=lipC PE=1 SV=1
10	AFDB:O53210	0.631	0.466	2.958E-13	421	0.261	0.188	O53210.pdb.gz	O53210_MYCTO Carboxylesterase family protein OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT2559 PE=4 SV=1
11	PDB:3aikA	0.647	0.687	5.219E-13	283	0.152	0.163	3aikA.pdb.gz
12	AFDB:O06832	0.704	0.521	6.725E-13	420	0.172	0.124	O06832.pdb.gz	O06832_MYCTU Probable esterase LipO OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=lipO PE=1 SV=1
13	PDB:4kryE	0.548	0.510	3.034E-12	329	0.188	0.173	4kryE.pdb.gz
14	PDB:5l2pA	0.647	0.642	3.411E-12	306	0.165	0.163	5l2pA.pdb.gz
15	PDB:2zsiA	0.562	0.510	5.376E-11	339	0.178	0.159	2zsiA.pdb.gz	Gibberellin-induced DELLA recognition by the gibberellin receptor GID1
16	PDB:6rt8A	0.571	0.553	1.458E-10	314	0.175	0.169	6rt8A.pdb.gz	Structural basis of cycloaddition in biosynthesis of iboga and aspidosperma alkaloids.
17	PDB:6rs4A	0.605	0.585	1.955E-10	315	0.168	0.162	6rs4A.pdb.gz
18	PDB:1vkhA	0.567	0.650	7.535E-10	261	0.109	0.126	1vkhA.pdb.gz
19	PDB:3eblA	0.546	0.515	9.528E-10	323	0.165	0.155	3eblA.pdb.gz	Structural basis for gibberellin recognition by its receptor GID1.
20	PDB:3c6bA	0.512	0.530	4.645E-9	291	0.149	0.155	3c6bA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q63HM1	0.0	634	303	1.000	1.000	KFA_HUMAN Kynurenine formamidase OS=Homo sapiens OX=9606 GN=AFMID PE=1 SV=2
2	Q8K4H1	1.27e-161	454	305	0.710	0.705	KFA_MOUSE Kynurenine formamidase OS=Mus musculus OX=10090 GN=Afmid PE=1 SV=1
3	Q9VMC9	1.66e-25	105	300	0.261	0.263	KFA_DROME Kynurenine formamidase OS=Drosophila melanogaster OX=7227 GN=KFase PE=1 SV=1
4	Q94AS5	3.59e-13	71.6	427	0.168	0.119	ICME_ARATH Isoprenylcysteine alpha-carbonyl methylesterase ICME OS=Arabidopsis thaliana OX=3702 GN=ICME PE=1 SV=1
5	G4REC9	4.16e-12	67.4	279	0.228	0.247	G4REC9_PELHB Esterase OS=Pelagibacterium halotolerans (strain DSM 22347 / JCM 15775 / CGMCC 1.7692 / B2) OX=1082931 GN=KKY_2869 PE=4 SV=1
6	Q8VYP9	4.32e-11	65.5	476	0.165	0.105	ICML1_ARATH Probable isoprenylcysteine alpha-carbonyl methylesterase ICMEL1 OS=Arabidopsis thaliana OX=3702 GN=ICMEL1 PE=2 SV=1
7	Q1PET6	5.91e-10	62.0	422	0.168	0.121	ICML2_ARATH Probable isoprenylcysteine alpha-carbonyl methylesterase ICMEL2 OS=Arabidopsis thaliana OX=3702 GN=ICMEL2 PE=2 SV=1
8	Q9SMM9	3.84e-06	50.1	329	0.208	0.191	CXE13_ARATH Probable carboxylesterase 13 OS=Arabidopsis thaliana OX=3702 GN=CXE13 PE=1 SV=1
9	Q9SMN0	1.22e-05	48.5	324	0.188	0.176	CXE12_ARATH Probable carboxylesterase 12 OS=Arabidopsis thaliana OX=3702 GN=CXE12 PE=1 SV=1
10	Q9LFR7	2.50e-04	44.7	344	0.149	0.131	CXE17_ARATH Probable carboxylesterase 17 OS=Arabidopsis thaliana OX=3702 GN=CXE17 PE=1 SV=1
11	P96402	3.24e-04	44.3	403	0.106	0.079	LIPC_MYCTU Esterase LipC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=lipC PE=1 SV=1
12	Q20826	6.51e-04	43.5	730	0.109	0.045	GLIT1_CAEEL Neuroligin-like protein glit-1 OS=Caenorhabditis elegans OX=6239 GN=glit-1 PE=1 SV=1
13	P9WK87	0.001	42.7	319	0.099	0.094	NLHH_MYCTU Carboxylesterase NlhH OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=nlhH PE=1 SV=1
14	Q99PG0	0.002	41.6	398	0.122	0.093	AAAD_MOUSE Arylacetamide deacetylase OS=Mus musculus OX=10090 GN=Aadac PE=1 SV=3
15	Q9LYC1	0.002	41.6	358	0.096	0.081	GID1B_ARATH Gibberellin receptor GID1B OS=Arabidopsis thaliana OX=3702 GN=GID1B PE=1 SV=1
16	O06832	0.003	41.2	420	0.106	0.076	O06832_MYCTU Probable esterase LipO OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=lipO PE=1 SV=1
17	A1ZA97	0.004	41.2	559	0.149	0.081	A1ZA97_DROME Carboxylic ester hydrolase OS=Drosophila melanogaster OX=7227 GN=Jhedup PE=1 SV=2
18	Q00675	0.004	40.8	286	0.109	0.115	STCI_EMENI Versiconal hemiacetal acetate esterase stcI OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=stcI PE=2 SV=1
19	Q6UEG5	0.004	40.8	314	0.099	0.096	AFLJ_ASPPU Versiconal hemiacetal acetate esterase OS=Aspergillus parasiticus (strain ATCC 56775 / NRRL 5862 / SRRC 143 / SU-1) OX=1403190 GN=aflJ PE=1 SV=1
20	Q9US38	0.004	40.8	341	0.092	0.082	YFZ3_SCHPO AB hydrolase superfamily protein C1039.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC1039.03 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07859 Abhydrolase_3	4.7e-12	57.8	alpha/beta hydrolase fold
2	PF12697 Abhydrolase_6	0.073	25.2	Alpha/beta hydrolase family
3	PF20434 BD-FAE	1.4e-10	52.6	BD-FAE
4	PF00135 COesterase	0.1	23.1	Carboxylesterase family
5	PF19680 DUF6182	3.6e+02	12.0	Family of unknown function (DUF6182)
6	PF00756 Esterase	2.1e+02	12.9	Putative esterase
7	PF03959 FSH1	1	20.5	Serine hydrolase (FSH1)
8	PF12146 Hydrolase_4	0.18	22.6	Serine aminopeptidase, S33
9	PF10230 LIDHydrolase	0.44	21.7	Lipid-droplet associated hydrolase
10	PF01764 Lipase_3	48	15.2	Lipase (class 3)
11	PF01936 NYN	1.8e+02	14.0	NYN domain
12	PF00326 Peptidase_S9	0.91	20.5	Prolyl oligopeptidase family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000328938

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000355517	0.987	Kynurenine 3-monooxygenase
2	9606.ENSP00000264170	0.984	Kynureninase
3	9606.ENSP00000444788	0.977	Tryptophan 2,3-dioxygenase
4	9606.ENSP00000443432	0.963	Indoleamine 2,3-dioxygenase 2
5	9606.ENSP00000399415	0.962	Kynurenine--oxoglutarate transaminase 1
6	9606.ENSP00000260508	0.959	Kynurenine--oxoglutarate transaminase 3
7	9606.ENSP00000423190	0.956	Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial
8	9606.ENSP00000430950	0.936	Indoleamine 2,3-dioxygenase 1
9	9606.ENSP00000403644	0.912	Aromatic-L-amino-acid decarboxylase
10	9606.ENSP00000245206	0.911	Aspartate aminotransferase, mitochondrial
11	9606.ENSP00000299299	0.851	Pterin-4-alpha-carbinolamine dehydratase
12	9606.ENSP00000386935	0.838	UDP-N-acetylhexosamine pyrophosphorylase-like protein 1
13	9606.ENSP00000327070	0.828	Malate dehydrogenase, mitochondrial
14	9606.ENSP00000377532	0.816	Pyruvate carboxylase, mitochondrial
15	9606.ENSP00000355518	0.806	Fumarate hydratase, mitochondrial
16	9606.ENSP00000216780	0.804	Phosphoenolpyruvate carboxykinase [GTP], mitochondrial
17	9606.ENSP00000319814	0.804	Phosphoenolpyruvate carboxykinase, cytosolic [GTP]
18	9606.ENSP00000321070	0.804	NAD-dependent malic enzyme, mitochondrial
19	9606.ENSP00000358719	0.804	Malic enzyme 1
20	9606.ENSP00000440246	0.804	NADP-dependent malic enzyme, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0003824	0.992	catalytic activity
GO:0016787	0.959	hydrolase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.996	organic substance metabolic process
GO:0044238	0.996	primary metabolic process
GO:0034641	0.993	cellular nitrogen compound metabolic process
GO:0009072	0.992	aromatic amino acid metabolic process
GO:1901361	0.991	organic cyclic compound catabolic process
GO:1901605	0.991	alpha-amino acid metabolic process
GO:0006576	0.990	biogenic amine metabolic process
GO:1901565	0.987	organonitrogen compound catabolic process
GO:0046483	0.985	heterocycle metabolic process
GO:0044248	0.983	cellular catabolic process
GO:0044282	0.982	small molecule catabolic process
GO:0006586	0.982	indolalkylamine metabolic process
GO:0006568	0.965	tryptophan metabolic process
GO:0019439	0.959	aromatic compound catabolic process
GO:0046395	0.899	carboxylic acid catabolic process
GO:0009063	0.716	amino acid catabolic process
GO:0046700	0.640	heterocycle catabolic process
GO:0009074	0.601	aromatic amino acid family catabolic process
GO:1901606	0.583	alpha-amino acid catabolic process
GO:0042537	0.451	benzene-containing compound metabolic process
GO:0044270	0.435	cellular nitrogen compound catabolic process
GO:0042180	0.425	cellular ketone metabolic process
GO:0006569	0.362	tryptophan catabolic process
GO:0070189	0.348	kynurenine metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043227	0.953	membrane-bounded organelle
GO:0043229	0.852	intracellular organelle
GO:0043231	0.657	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.959	Hydrolases.

[back to server]