StarFunc result for job id Q63HM2

User Input

>input (1172 residues)
MSPDVPLLNDYKQDFFLKRFPQTVLGGPRFKLGYCAPPYIYVNQIILFLMPWVWGGVGTL
LYQLGILKDYYTAALSGGLMLFTAFVIQFTSLYAKNKSTTVERILTTDILAEEDEHEFTS
CTGAETVKFLIPGKKYVANTVFHSILAGLACGLGTWYLLPNRITLLYGSTGGTALLFFFG
WMTLCIAEYSLIVNTATETATFQTQDTYEIIPLMRPLYIFFFVSVDLAHRFVVNMPALEH
MNQILHILFVFLPFLWALGTLPPPDALLLWAMEQVLEFGLGGSSMSTHLRLLVMFIMSAG
TAIASYFIPSTVGVVLFMTGFGFLLSLNLSDMGHKIGTKSKDLPSGPEKHFSWKECLFYI
IILVLALLETSLLHHFAGFSQISKSNSQAIVGYGLMILLIILWILREIQSVYIIGIFRNP
FYPKDVQTVTVFFEKQTRLMKIGIVRRILLTLVSPFAMIAFLSLDSSLQGLHSVSVCIGF
TRAFRMVWQNTENALLETVIVSTVHLISSTDIWWNRSLDTGLRLLLVGIIRDRLIQFISK
LQFAVTVLLTSWTEKKQRRKTTATLCILNIVFSPFVLVIIVFSTLLSSPLLPLFTLPVFL
VGFPRPIQSWPGAAGTTACVCADTVYYYQMVPRLTAVLQTAMAAGSLGLLLPGSHYLGRF
QDRLMWIMILECGYTYCSINIKGLELQETSCHTAEARRVDEVFEDAFEQEYTRVCSLNEH
FGNVLTPCTVLPVKLYSDARNVLSGIIDSHENLKEFKGDLIKVLVWILVQYCSKRPGMKE
NVHNTENKGKAPLMLPALNTLPPPKSPEDIDSLNSETFNDWSDDNIFDDEPTIKKVIEEK
HQLKDLPGTNLFIPGSVESQRVGDHSTGTVPENDLYKAVLLGYPAVDKGKQEDMPYIPLM
EFSCSHSHLVCLPAEWRTSCMPSSKMKEMSSLFPEDWYQFVLRQLECYHSEEKASNVLEE
IAKDKVLKDFYVHTVMTCYFSLFGIDNMAPSPGHILRVYGGVLPWSVALDWLTEKPELFQ
LALKAFRYTLKLMIDKASLGPIEDFRELIKYLEEYERDWYIGLVSDEKWKEAILQEKPYL
FSLGYDSNMGIYTGRVLSLQELLIQVGKLNPEAVRGQWANLSWELLYATNDDEERYSIQA
HPLLLRNLTVQAAEPPLGYPIYSSKPLHIHLY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q63HM2	1.000	1.000	0.000	1172	1.000	1.000	Q63HM2.pdb.gz	PCX4_HUMAN Pecanex-like protein 4 OS=Homo sapiens OX=9606 GN=PCNX4 PE=1 SV=4
2	AFDB:Q8VCB1	0.062	0.087	2.699E-2	673	0.080	0.140	Q8VCB1.pdb.gz	NDC1_MOUSE Nucleoporin NDC1 OS=Mus musculus OX=10090 GN=Ndc1 PE=1 SV=1
3	AFDB:Q92608	0.096	0.072	1.780E-1	1830	0.083	0.053	Q92608.pdb.gz	DOCK2_HUMAN Dedicator of cytokinesis protein 2 OS=Homo sapiens OX=9606 GN=DOCK2 PE=1 SV=2
4	PDB:4ja4A	0.089	0.179	2.837E-1	442	0.057	0.152	4ja4A.pdb.gz
5	PDB:6s4mA	0.062	0.125	5.697E-1	426	0.055	0.153	6s4mA.pdb.gz
6	PDB:5lzrB	0.067	0.095	8.944E-1	697	0.061	0.102	5lzrB.pdb.gz	Membrane pyrophosphatases from Thermotoga maritima and Vigna radiata suggest a conserved coupling mechanism.
7	PDB:5glhA	0.067	0.128	1.463	452	0.058	0.150	5glhA.pdb.gz	Activation mechanism of endothelin ETB receptor by endothelin-1.
8	PDB:6qm5A	0.061	0.092	1.463	673	0.065	0.113	6qm5A.pdb.gz	Stepwise activation mechanism of the scramblase nhTMEM16 revealed by cryo-EM.
9	PDB:6kpcA	0.091	0.195	1.949	445	0.049	0.130	6kpcA.pdb.gz	Activation and Signaling Mechanism Revealed by Cannabinoid Receptor-GiComplex Structures.
10	AFDB:A0A0B4K7Q6	0.086	0.061	2.000	2008	0.097	0.057	A0A0B4K7Q6.pdb.gz	A0A0B4K7Q6_DROME Myoblast city, isoform B OS=Drosophila melanogaster OX=7227 GN=mbc PE=3 SV=1
11	PDB:7b93L	0.082	0.130	2.297	607	0.072	0.138	7b93L.pdb.gz	Cork-in-bottle mechanism of inhibitor binding to mammalian complex I.
12	PDB:6fmrA	0.063	0.121	2.393	475	0.061	0.149	6fmrA.pdb.gz	In situ serial crystallography for rapid de novo membrane protein structure determination.
13	PDB:3ripA	0.064	0.094	2.493	568	0.050	0.104	3ripA.pdb.gz
14	PDB:6j6gA	0.043	0.033	2.493	1913	0.053	0.032	6j6gA.pdb.gz	Structures of the Catalytically Activated Yeast Spliceosome Reveal the Mechanism of Branching.
15	AFDB:Q4GYI9	0.067	0.052	2.558	1737	0.098	0.066	Q4GYI9.pdb.gz	Q4GYI9_TRYB2 Fusaric acid resistance protein-like OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.3880 PE=4 SV=1
16	AFDB:Q3UV55	0.050	0.072	3.272	615	0.036	0.068	Q3UV55.pdb.gz	NR1D1_MOUSE Nuclear receptor subfamily 1 group D member 1 OS=Mus musculus OX=10090 GN=Nr1d1 PE=1 SV=1
17	AFDB:P01129	0.045	0.058	4.185	767	0.044	0.068	P01129.pdb.gz	CDC10_SCHPO Start control protein cdc10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cdc10 PE=1 SV=1
18	AFDB:Q6AI14	0.063	0.075	8.754	798	0.079	0.117	Q6AI14.pdb.gz	SL9A4_HUMAN Sodium/hydrogen exchanger 4 OS=Homo sapiens OX=9606 GN=SLC9A4 PE=2 SV=2
19	AFDB:Q92540	0.068	0.070	8.754	1137	0.077	0.079	Q92540.pdb.gz	SMG7_HUMAN Nonsense-mediated mRNA decay factor SMG7 OS=Homo sapiens OX=9606 GN=SMG7 PE=1 SV=2
20	AFDB:O70372	0.058	0.060	9.502	1122	0.054	0.056	O70372.pdb.gz	TERT_MOUSE Telomerase reverse transcriptase OS=Mus musculus OX=10090 GN=Tert PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q63HM2	0.0	2412	1172	1.000	1.000	PCX4_HUMAN Pecanex-like protein 4 OS=Homo sapiens OX=9606 GN=PCNX4 PE=1 SV=4
2	A6NKB5	1.68e-13	78.2	2137	0.044	0.024	PCX2_HUMAN Pecanex-like protein 2 OS=Homo sapiens OX=9606 GN=PCNX2 PE=1 SV=3
3	P18490	1.04e-11	72.4	3413	0.044	0.015	PCX_DROME Protein pecanex OS=Drosophila melanogaster OX=7227 GN=pcx PE=2 SV=4
4	P9WMW1	3.2	34.3	863	0.023	0.031	PHSG_MYCTU Glycogen phosphorylase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=glgP PE=1 SV=1
5	Q9FIM1	8.4	33.1	1088	0.019	0.020	Q9FIM1_ARATH Similarity to unknown protein OS=Arabidopsis thaliana OX=3702 GN=At5g58880 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05041 Pecanex_C	4e-21	87.1	Pecanex protein (C-terminus)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_008955245.1

Rank	PPI partner	STRING score	Description
1	9597.XP_003817358.1	0.634	Regulation of nuclear pre-mRNA domain containing 2
2	9597.XP_003820737.1	0.541	TBC1 domain family member 9

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.988	cellular process
GO:0071704	0.807	organic substance metabolic process
GO:0044238	0.761	primary metabolic process
GO:0006807	0.742	nitrogen compound metabolic process
GO:0043170	0.732	macromolecule metabolic process
GO:0044237	0.661	cellular metabolic process
GO:0065007	0.589	biological regulation
GO:0044260	0.525	cellular macromolecule metabolic process
GO:0051179	0.427	localization
GO:0050794	0.396	regulation of cellular process
GO:0050896	0.395	response to stimulus
GO:0051641	0.371	cellular localization
GO:0000003	0.344	reproduction
GO:0051234	0.344	establishment of localization
GO:1901564	0.344	organonitrogen compound metabolic process
GO:0032501	0.313	multicellular organismal process
GO:0019222	0.312	regulation of metabolic process
GO:0022414	0.303	reproductive process
GO:0019538	0.303	protein metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	0.995	intracellular membrane-bounded organelle
GO:0005654	0.958	nucleoplasm
GO:0016020	0.955	membrane
GO:0005737	0.947	cytoplasm
GO:0032991	0.896	protein-containing complex
GO:0012505	0.838	endomembrane system
GO:1902494	0.771	catalytic complex
GO:0005783	0.713	endoplasmic reticulum
GO:1990234	0.623	transferase complex
GO:0005789	0.389	endoplasmic reticulum membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]