StarFunc result for job id Q63HN8

User Input

>input (1400 residues)
MECPSCQHVSKEETPKFCSQCGERLPPAAPIADSENNNSTMASASEGEMECGQELKEEGG
PCLFPGSDSWQENPEEPCSKASWTVQESKKKKRKKKKKGNKSASSELASLPLSPASPCHL
TLLSNPWPQDTALPHSQAQQSGPTGQPSQPPGTATTPLEGDGLSAPTEVGDSPLQAQALG
EAGVATGSEAQSSPQFQDHTEGEDQDASIPSGGRGLSQEGTGPPTSAGEGHSRTEDAAQE
LLLPESKGGSSEPGTELQTTEQQAGASASMAVDAVAEPANAVKGAGKEMKEKTQRMKQPP
ATTPPFKTHCQEAETKTKDEMAAAEEKVGKNEQGEPEDLKKPEGKNRSAAAVKNEKEQKN
QEADVQEVKASTLSPGGGVTVFFHAIISLHFPFNPDLHKVFIRGGEEFGESKWDSNICEL
HYTRDLGHDRVLVEGIVCISKKHLDKYIPYKYVIYNGESFEYEFIYKHQQKKGEYVNRCL
FIKSSLLGSGDWHQYYDIVYMKPHGRLQKVMNHITDGPRKDLVKGKQIAAALMLDSTFSI
LQTWDTINLNSFFTQFEQFCFVLQQPMIYEGQAQLWTDLQYREKEVKRYLWQHLKKHVVP
LPDGKSTDFLPVDCPVRSKLKTGLIVLFVVEKIELLLEGSLDWLCHLLTSDASSPDEFHR
DLSHILGIPQSWRLYLVNLCQRCMDTRTYTWLGALPVLHCCMELAPRHKDAWRQPEDTWA
ALEGLSFSPFREQMLDTSSLLQFMREKQHLLSIDEPLFRSWFSLLPLSHLVMYMENFIEH
LGRFPAHILDCLSGIYYRLPGLEQVLNTQDVQDVQNVQNILEMLLRLLDTYRDKIPEEAL
SPSYLTVCLKLHEAICSSTKLLKFYELPALSAEIVCRMIRLLSLVDSAGQRDETGNNSVQ
TVFQGTLAATKRWLREVFTKNMLTSSGASFTYVKEIEVWRRLVEIQFPAEHGWKESLLGD
MEWRLTKEEPLSQITAYCNSCWDTKGLEDSVAKTFEKCIIEAVSSACQSQTSILQGFSYS
DLRKFGIVLSAVITKSWPRTADNFNDILKHLLTLADVKHVFRLCGTDEKILANVTEDAKR
LIAVADSVLTKVVGDLLSGTILVGQLELIIKHKNQFLDIWQLREKSLSPQDEQCAVEEAL
DWRREELLLLKKEKRCVDSLLKMCGNVKHLIQVDFGVLAVRHSQDLSSKRLNDTVTVRLS
TSSNSQRATHYHLSSQVQEMAGKIDLLRDSHIFQLFWREAAEPLSEPKEDQEAAELLSEP
EEESERHILELEEVYDYLYQPSYRKFIKLHQDLKSGEVTLAEIDVIFKDFVNKYTDLDSE
LKIMCTVDHQDQRDWIKDRVEQIKEYHHLHQAVHAAKVILQVKESLGLNGDFSVLNTLLN
FTDNFDDFRRETLDQINQEL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7oikA	0.528	0.173	1.379E-43	4426	0.301	0.095	7oikA.pdb.gz	E3 ubiquitin ligase RNF213 employs a non-canonical zinc finger active site and is allosterically regulated by ATP
2	AFDB:Q68CQ1	0.121	0.125	5.722E-7	1323	0.124	0.132	Q68CQ1.pdb.gz	MROH7_HUMAN Maestro heat-like repeat-containing protein family member 7 OS=Homo sapiens OX=9606 GN=MROH7 PE=2 SV=4
3	AFDB:Q99569	0.093	0.103	6.637E-5	1192	0.105	0.123	Q99569.pdb.gz	PKP4_HUMAN Plakophilin-4 OS=Homo sapiens OX=9606 GN=PKP4 PE=1 SV=2
4	AFDB:Q9P2D8	0.105	0.072	1.140E-4	2635	0.108	0.057	Q9P2D8.pdb.gz	UNC79_HUMAN Protein unc-79 homolog OS=Homo sapiens OX=9606 GN=UNC79 PE=1 SV=4
5	AFDB:Q9W517	0.076	0.070	1.280E-4	1741	0.097	0.078	Q9W517.pdb.gz	WAPL_DROME Protein wings apart-like OS=Drosophila melanogaster OX=7227 GN=wapl PE=1 SV=1
6	AFDB:Q8IN05	0.080	0.079	1.744E-4	1415	0.113	0.112	Q8IN05.pdb.gz	Q8IN05_DROME Liquid facets-Related, isoform D OS=Drosophila melanogaster OX=7227 GN=lqfR PE=1 SV=2
7	AFDB:Q38CX9	0.085	0.086	2.668E-4	1378	0.092	0.094	Q38CX9.pdb.gz	Q38CX9_TRYB2 CHAT domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.244.2660 PE=4 SV=1
8	AFDB:F1RBK4	0.099	0.107	3.237E-4	1216	0.093	0.107	F1RBK4.pdb.gz
9	AFDB:E5FYH1	0.086	0.079	3.364E-4	1653	0.101	0.085	E5FYH1.pdb.gz	TOPZ1_MOUSE Protein TOPAZ1 OS=Mus musculus OX=10090 GN=Topaz1 PE=2 SV=1
10	AFDB:A0A0R4IZ84	0.086	0.082	5.147E-4	1544	0.109	0.099	A0A0R4IZ84.pdb.gz	EST1A_DANRE Telomerase-binding protein EST1A OS=Danio rerio OX=7955 GN=smg6 PE=2 SV=1
11	AFDB:G5E870	0.089	0.072	5.780E-4	2025	0.109	0.076	G5E870.pdb.gz	TRIPC_MOUSE E3 ubiquitin-protein ligase TRIP12 OS=Mus musculus OX=10090 GN=Trip12 PE=1 SV=1
12	PDB:6vaeA	0.090	0.099	4.897E-3	1198	0.088	0.103	6vaeA.pdb.gz	DNA clamp function of the monoubiquitinated Fanconi anaemia ID complex.
13	PDB:7mopA	0.141	0.096	6.672E-3	2445	0.085	0.049	7mopA.pdb.gz	Solenoid architecture of HUWE1 contributes to ligase activity and substrate recognition.
14	PDB:7sukSP	0.126	0.095	6.672E-3	2234	0.089	0.056	7sukSP.pdb.gz	Artificial intelligence-assisted cryoEM structure of Bfr2-Lcp5 complex observed in the yeast small subunit processome.
15	PDB:3wyfC	0.108	0.133	7.208E-3	1040	0.070	0.094	3wyfC.pdb.gz	Structural insights into how yrb2p accelerates the assembly of the xpo1p nuclear export complex
16	PDB:7dkhI	0.095	0.127	7.492E-3	914	0.067	0.103	7dkhI.pdb.gz
17	PDB:7ay1A	0.090	0.109	9.447E-3	1033	0.081	0.109	7ay1A.pdb.gz	Structural basis of FANCD2 deubiquitination by USP1-UAF1.
18	PDB:3gjxA	0.097	0.119	1.061E-2	1041	0.084	0.113	3gjxA.pdb.gz	Crystal Structure of the Nuclear Export Receptor CRM1 in Complex with Snurportin1 and RanGTP.
19	PDB:6n1zA	0.091	0.115	1.146E-2	961	0.064	0.093	6n1zA.pdb.gz
20	PDB:7qdrB	0.062	0.061	1.146E-2	1212	0.080	0.092	7qdrB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0A0MTC1	0.0	2886	5256	0.999	0.266	A0A0A0MTC1_HUMAN Ring finger protein 213 OS=Homo sapiens OX=9606 GN=RNF213 PE=1 SV=1
2	A0A0A0MTR7	0.0	2909	5207	0.999	0.269	A0A0A0MTR7_HUMAN Ring finger protein 213 OS=Homo sapiens OX=9606 GN=RNF213 PE=1 SV=1
3	E9Q555	0.0	1245	5148	0.499	0.136	RN213_MOUSE E3 ubiquitin-protein ligase RNF213 OS=Mus musculus OX=10090 GN=Rnf213 PE=1 SV=3
4	Q63HN8	0.0	2911	5207	1.000	0.269	RN213_HUMAN E3 ubiquitin-protein ligase RNF213 OS=Homo sapiens OX=9606 GN=RNF213 PE=1 SV=3
5	A0A0R4IBK5	1.20e-141	484	5209	0.285	0.077	R213A_DANRE E3 ubiquitin-protein ligase rnf213-alpha OS=Danio rerio OX=7955 GN=rnf213a PE=3 SV=1
6	G5ED37	0.45	37.4	820	0.028	0.048	G5ED37_CAEEL Intraflagellar transport protein 88 homolog OS=Caenorhabditis elegans OX=6239 GN=osm-5 PE=2 SV=1
7	Q557G6	0.54	37.4	5630	0.020	0.005	Q557G6_DICDI AAA+ ATPase, core domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0273573 PE=4 SV=3
8	Q557Q0	0.54	37.4	5630	0.020	0.005	Q557Q0_DICDI AAA+ ATPase, core domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0273451 PE=4 SV=2
9	Q8JSZ3	0.65	37.0	1684	0.024	0.020	GP_CCHFI Envelopment polyprotein OS=Crimean-Congo hemorrhagic fever virus (strain Nigeria/IbAr10200/1970) OX=652961 GN=GP PE=1 SV=1
10	Q9Y6V0	0.92	36.6	5142	0.045	0.012	PCLO_HUMAN Protein piccolo OS=Homo sapiens OX=9606 GN=PCLO PE=1 SV=5
11	Q8TDX9	0.96	36.6	2849	0.035	0.017	PK1L1_HUMAN Polycystin-1-like protein 1 OS=Homo sapiens OX=9606 GN=PKD1L1 PE=1 SV=1
12	B1H1X1	1.3	35.8	673	0.020	0.042	FXL17_XENLA F-box/LRR-repeat protein 17 OS=Xenopus laevis OX=8355 GN=fbxl17 PE=2 SV=1
13	Q9QXZ0	2.3	35.4	7354	0.024	0.004	MACF1_MOUSE Microtubule-actin cross-linking factor 1, isoforms 1/2/3/4 OS=Mus musculus OX=10090 GN=Macf1 PE=1 SV=2
14	Q6UX39	2.8	33.9	209	0.024	0.163	AMTN_HUMAN Amelotin OS=Homo sapiens OX=9606 GN=AMTN PE=1 SV=1
15	Q99102	2.8	35.0	5412	0.037	0.010	MUC4_HUMAN Mucin-4 OS=Homo sapiens OX=9606 GN=MUC4 PE=1 SV=5
16	A1A5D2	2.9	34.7	748	0.024	0.044	A1A5D2_HUMAN SNX26 protein OS=Homo sapiens OX=9606 GN=SNX26 PE=1 SV=1
17	O14559	3.7	34.7	1287	0.024	0.026	RHG33_HUMAN Rho GTPase-activating protein 33 OS=Homo sapiens OX=9606 GN=ARHGAP33 PE=1 SV=2
18	A0A8I6AJS5	4.7	34.3	1309	0.024	0.025	A0A8I6AJS5_RAT Rho GTPase activating protein 33 OS=Rattus norvegicus OX=10116 GN=Arhgap33 PE=3 SV=1
19	D4A9G6	4.7	34.3	1354	0.024	0.024	D4A9G6_RAT Rho GTPase activating protein 33 OS=Rattus norvegicus OX=10116 GN=Arhgap33 PE=1 SV=4
20	Q80YF9	4.8	34.3	1305	0.024	0.025	RHG33_MOUSE Rho GTPase-activating protein 33 OS=Mus musculus OX=10090 GN=Arhgap33 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08772 NOB1_Zn_bind	23	16.5	Nin one binding (NOB1) Zn-ribbon like
2	PF14803 Nudix_N_2	2.7e+02	12.9	Nudix N-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000464087

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000418194	0.870	Poly [ADP-ribose] polymerase 14
2	9606.ENSP00000259030	0.751	Receptor-transporting protein 4
3	9606.ENSP00000371471	0.744	Radical S-adenosyl methionine domain-containing protein 2
4	9606.ENSP00000251642	0.718	Probable ATP-dependent RNA helicase DHX58
5	9606.ENSP00000368699	0.712	Ubiquitin-like protein ISG15
6	9606.ENSP00000215794	0.703	Ubl carboxyl-terminal hydrolase 18
7	9606.ENSP00000296161	0.696	E3 ubiquitin-protein ligase DTX3L
8	9606.ENSP00000355384	0.683	Sodium-independent sulfate anion transporter
9	9606.ENSP00000333266	0.682	Ubiquitin-like modifier-activating enzyme 7
10	9606.ENSP00000333657	0.670	Interferon-induced GTP-binding protein Mx2
11	9606.ENSP00000460665	0.654	Coiled-coil glutamate rich protein 2
12	9606.ENSP00000381601	0.644	Interferon-induced GTP-binding protein Mx1
13	9606.ENSP00000314606	0.641	N-sulphoglucosamine sulphohydrolase
14	9606.ENSP00000377344	0.640	Probable ATP-dependent RNA helicase DDX60
15	9606.ENSP00000360883	0.627	Interferon-induced protein with tetratricopeptide repeats 3
16	9606.ENSP00000358496	0.611	Cx9C motif-containing protein 4
17	9606.ENSP00000359783	0.610	Interferon-induced protein 44
18	9606.ENSP00000442050	0.609	Ethanolamine-phosphate cytidylyltransferase
19	9606.ENSP00000399700	0.606	Placenta-specific gene 8 protein
20	9606.ENSP00000263642	0.598	Interferon-induced helicase C domain-containing protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0061630	1.000	ubiquitin protein ligase activity
GO:0016887	1.000	ATP hydrolysis activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.967	organic substance metabolic process
GO:0044237	0.966	cellular metabolic process
GO:0044238	0.965	primary metabolic process
GO:0098542	0.958	defense response to other organism
GO:0051179	0.898	localization
GO:0006629	0.889	lipid metabolic process
GO:0009056	0.859	catabolic process
GO:0030258	0.858	lipid modification
GO:0044248	0.850	cellular catabolic process
GO:0035239	0.845	tube morphogenesis
GO:0001525	0.837	angiogenesis
GO:0051235	0.779	maintenance of location
GO:0019915	0.752	lipid storage
GO:0071840	0.513	cellular component organization or biogenesis
GO:0006807	0.507	nitrogen compound metabolic process
GO:0044085	0.443	cellular component biogenesis
GO:0050789	0.441	regulation of biological process
GO:0050794	0.434	regulation of cellular process
GO:0043170	0.426	macromolecule metabolic process
GO:0061919	0.396	process utilizing autophagic mechanism
GO:0016236	0.365	macroautophagy
GO:0061912	0.353	selective autophagy
GO:0048519	0.339	negative regulation of biological process
GO:1901564	0.339	organonitrogen compound metabolic process
GO:0022607	0.339	cellular component assembly
GO:0048583	0.337	regulation of response to stimulus
GO:0048523	0.333	negative regulation of cellular process
GO:0140694	0.312	non-membrane-bounded organelle assembly
GO:0019222	0.308	regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005730	1.000	nucleolus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	1.000	Transferases.
RHEA:13065	1.000	ATP + H2O = ADP + H(+) + phosphate

[back to server]