StarFunc result for job id Q63HQ0

User Input

>input (302 residues)
MGNCCWTQCFGLLRKEAGRLQRVGGGGGSKYFRTCSRGEHLTIEFENLVESDEGESPGSS
HRPLTEEEIVDLRERHYDSIAEKQKDLDKKIQKELALQEEKLRLEEEALYAAQREAARAA
KQRKLLEQERQRIVQQYHPSNNGEYQSSGPEDDFESCLRNMKSQYEVFRSSRLSSDATVL
TPNTESSCDLMTKTKSTSGNDDSTSLDLEWEDEEGMNRMLPMRERSKTEEDILRAALKYS
NKKTGSNPTSASDDSNGLEWENDFVSAEMDDNGNSEYSGFVNPVLELSDSGIRHSDTDQQ
TR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q63HQ0	1.000	1.000	1.999E-44	302	1.000	1.000	Q63HQ0.pdb.gz	AP1AR_HUMAN AP-1 complex-associated regulatory protein OS=Homo sapiens OX=9606 GN=AP1AR PE=1 SV=1
2	AFDB:O94560	0.173	0.098	8.142E-2	612	0.149	0.074	O94560.pdb.gz	YGD1_SCHPO Uncharacterized WD repeat-containing protein C1773.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1773.01 PE=4 SV=1
3	AFDB:Q62418	0.182	0.149	1.064E-1	436	0.129	0.089	Q62418.pdb.gz	DBNL_MOUSE Drebrin-like protein OS=Mus musculus OX=10090 GN=Dbnl PE=1 SV=2
4	AFDB:Q9VU88	0.179	0.091	2.219E-1	680	0.189	0.084	Q9VU88.pdb.gz	Q9VU88_DROME AT31531p OS=Drosophila melanogaster OX=7227 GN=Liprin-beta PE=2 SV=1
5	AFDB:Q9FK72	0.189	0.169	2.536E-1	345	0.123	0.107	Q9FK72.pdb.gz	HFA4C_ARATH Heat stress transcription factor A-4c OS=Arabidopsis thaliana OX=3702 GN=HSFA4C PE=2 SV=1
6	AFDB:A0A2R8QDA7	0.094	0.080	2.899E-1	364	0.162	0.135	A0A2R8QDA7.pdb.gz
7	AFDB:Q95Y36	0.197	0.098	2.899E-1	685	0.119	0.053	Q95Y36.pdb.gz	CFA36_CAEEL Cilia- and flagella-associated protein 36 OS=Caenorhabditis elegans OX=6239 GN=cfap-36 PE=2 SV=1
8	AFDB:A3KMS7	0.111	0.069	3.099E-1	558	0.139	0.075	A3KMS7.pdb.gz
9	AFDB:P49455	0.195	0.120	4.329E-1	518	0.099	0.058	P49455.pdb.gz	TPM4_DROME Tropomyosin-1, isoforms 33/34 OS=Drosophila melanogaster OX=7227 GN=Tm1 PE=2 SV=2
10	AFDB:Q9BIW6	0.099	0.047	4.628E-1	749	0.123	0.049	Q9BIW6.pdb.gz	Q9BIW6_DROME Brahma-associated protein 111kD OS=Drosophila melanogaster OX=7227 GN=Bap111 PE=2 SV=1
11	PDB:7r5jV0	0.109	0.120	3.977	273	0.103	0.114	7r5jV0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
12	PDB:2p22C	0.164	0.238	9.481	186	0.086	0.140	2p22C.pdb.gz
13	PDB:6hivAg	0.083	0.097	9.481	259	0.083	0.097	6hivAg.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9PYF7	0.0	527	298	0.901	0.913	E9PYF7_MOUSE AP1AR OS=Mus musculus OX=10090 GN=Ap1ar PE=1 SV=1
2	Q63HQ0	0.0	624	302	1.000	1.000	AP1AR_HUMAN AP-1 complex-associated regulatory protein OS=Homo sapiens OX=9606 GN=AP1AR PE=1 SV=1
3	A0A0G2JG85	1.90e-171	477	265	0.795	0.906	A0A0G2JG85_MOUSE Adaptor-related protein complex 1 associated regulatory protein OS=Mus musculus OX=10090 GN=Ap1ar PE=1 SV=1
4	Q99LV9	3.51e-51	165	86	0.268	0.942	Q99LV9_MOUSE BC002199 protein OS=Mus musculus OX=10090 GN=Ap1ar PE=2 SV=1
5	H0Y8Y4	2.40e-45	150	76	0.242	0.961	H0Y8Y4_HUMAN Adaptor related protein complex 1 associated regulatory protein (Fragment) OS=Homo sapiens OX=9606 GN=AP1AR PE=1 SV=1
6	A0A0G2JEZ5	9.41e-13	63.5	40	0.079	0.600	A0A0G2JEZ5_MOUSE Adaptor-related protein complex 1 associated regulatory protein OS=Mus musculus OX=10090 GN=Ap1ar PE=4 SV=1
7	Q5DU05	0.30	35.4	1446	0.099	0.021	CE164_MOUSE Centrosomal protein of 164 kDa OS=Mus musculus OX=10090 GN=Cep164 PE=1 SV=2
8	H2LP95	1.6	33.1	1067	0.096	0.027	TBC31_ORYLA TBC1 domain family member 31 OS=Oryzias latipes OX=8090 GN=tbc1d31 PE=3 SV=2
9	Q9VWA8	2.8	31.6	262	0.079	0.092	FRG1_DROME Protein FRG1 homolog OS=Drosophila melanogaster OX=7227 GN=FRG1 PE=2 SV=1
10	Q9FZF2	3.2	31.2	184	0.096	0.158	Q9FZF2_ARATH AGAMOUS-like 102 OS=Arabidopsis thaliana OX=3702 GN=AGL102 PE=1 SV=1
11	Q1MTN9	7.9	30.8	544	0.060	0.033	RLF2_SCHPO Chromatin assembly factor 1 subunit rlf2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rlf2 PE=1 SV=2
12	Q8MT65	9.5	30.4	1351	0.099	0.022	Q8MT65_DROME RE01412p OS=Drosophila melanogaster OX=7227 GN=Grip163 PE=2 SV=1
13	Q9VTS3	9.6	30.4	1351	0.099	0.022	Q9VTS3_DROME Grip163 OS=Drosophila melanogaster OX=7227 GN=Grip163 PE=1 SV=2
14	Q9GP62	9.7	30.4	1351	0.099	0.022	Q9GP62_DROME Gamma tubulin ring protein OS=Drosophila melanogaster OX=7227 GN=Grip163 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15745 AP1AR	1.2e-151	515.6	AP-1 complex-associated regulatory protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000274000

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000231524	0.766	E3 ubiquitin-protein ligase TRIM23
2	9606.ENSP00000285979	0.739	Cytochrome P450 2C18
3	9606.ENSP00000377148	0.704	AP-1 complex subunit gamma-1
4	9606.ENSP00000260682	0.683	Cytochrome P450 2C9
5	9606.ENSP00000360317	0.681	Cytochrome P450 2C8
6	9606.ENSP00000260970	0.664	Peptidyl-prolyl cis-trans isomerase G
7	9606.ENSP00000360372	0.652	Cytochrome P450 2C19
8	9606.ENSP00000353820	0.642	Cytochrome P450 2D6
9	9606.ENSP00000333833	0.639	CKLF like MARVEL transmembrane domain containing 4
10	9606.ENSP00000424079	0.622	NHS-like protein 2
11	9606.ENSP00000337915	0.611	Cytochrome P450 3A4
12	9606.ENSP00000445408	0.604	Rab GTPase-binding effector protein 1
13	9606.ENSP00000256447	0.598	CD180 antigen
14	9606.ENSP00000324648	0.593	Cytochrome P450 2B6
15	9606.ENSP00000262215	0.580	Brefeldin A-inhibited guanine nucleotide-exchange protein 1
16	9606.ENSP00000236671	0.576	Cathepsin D
17	9606.ENSP00000342007	0.565	Cytochrome P450 1A2
18	9606.ENSP00000369050	0.560	Cytochrome P450 1A1
19	9606.ENSP00000348380	0.551	Cytochrome P450 family 20 subfamily A member 1
20	9606.ENSP00000299638	0.539	DNA-directed RNA polymerase II subunit GRINL1A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0035650	1.000	AP-1 adaptor complex binding
GO:0019894	1.000	kinesin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0065007	0.997	biological regulation
GO:0050794	0.968	regulation of cellular process
GO:2000145	0.776	regulation of cell motility
GO:0051179	0.772	localization
GO:0048519	0.753	negative regulation of biological process
GO:0051641	0.729	cellular localization
GO:0051128	0.726	regulation of cellular component organization
GO:0030155	0.722	regulation of cell adhesion
GO:0040013	0.691	negative regulation of locomotion
GO:1900024	0.690	regulation of substrate adhesion-dependent cell spreading
GO:0010812	0.689	negative regulation of cell-substrate adhesion
GO:2000146	0.679	negative regulation of cell motility
GO:0033043	0.665	regulation of organelle organization
GO:1902903	0.644	regulation of supramolecular fiber organization
GO:0032970	0.640	regulation of actin filament-based process
GO:0051125	0.591	regulation of actin nucleation
GO:0033036	0.575	macromolecule localization
GO:0070727	0.542	cellular macromolecule localization
GO:0034446	0.326	substrate adhesion-dependent cell spreading
GO:0008104	0.300	protein localization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	1.000	endomembrane system
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0031982	0.994	vesicle
GO:0031410	0.984	cytoplasmic vesicle
GO:0005794	0.711	Golgi apparatus
GO:0005768	0.596	endosome
GO:0016020	0.568	membrane
GO:0030133	0.330	transport vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]