StarFunc result for job id Q63HQ2

User Input

>input (1017 residues)
MDLIRGVLLRLLLLASSLGPGAVSLRAAIRKPGKVGPPLDIKLGALNCTAFSIQWKMPRH
PGSPILGYTVFYSEVGADKSLQEQLHSVPLSRDIPTTEEVIGDLKPGTEYRVSIAAYSQA
GKGRLSSPRHVTTLSQDSCLPPAAPQQPHVIVVSDSEVALSWKPGASEGSAPIQYYSVEF
IRPDFDKKWTSIHERIQMDSMVIKGLDPDTNYQFAVRAMNSHGPSPRSWPSDIIRTLCPE
EAGSGRYGPRYITDMGAGEDDEGFEDDLDLDISFEEVKPLPATKGGNKKFLVESKKMSIS
NPKTISRLIPPTSASLPVTTVAPQPIPIQRKGKNGVAIMSRLFDMPCDETLCSADSFCVN
DYTWGGSRCQCTLGKGGESCSEDIVIQYPQFFGHSYVTFEPLKNSYQAFQITLEFRAEAE
DGLLLYCGENEHGRGDFMSLAIIRRSLQFRFNCGTGVAIIVSETKIKLGGWHTVMLYRDG
LNGLLQLNNGTPVTGQSQGQYSKITFRTPLYLGGAPSAYWLVRATGTNRGFQGCVQSLAV
NGRRIDMRPWPLGKALSGADVGECSSGICDEASCIHGGTCTAIKADSYICLCPLGFKGRH
CEDAFTLTIPQFRESLRSYAATPWPLEPQHYLSFMEFEITFRPDSGDGVLLYSYDTGSKD
FLSINLAGGHVEFRFDCGSGTGVLRSEDPLTLGNWHELRVSRTAKNGILQVDKQKIVEGM
AEGGFTQIKCNTDIFIGGVPNYDDVKKNSGVLKPFSGSIQKIILNDRTIHVKHDFTSGVN
VENAAHPCVRAPCAHGGSCRPRKEGYDCDCPLGFEGLHCQKECGNYCLNTIIEAIEIPQF
IGRSYLTYDNPDILKRVSGSRSNVFMRFKTTAKDGLLLWRGDSPMRPNSDFISLGLRDGA
LVFSYNLGSGVASIMVNGSFNDGRWHRVKAVRDGQSGKITVDDYGARTGKSPGMMRQLNI
NGALYVGGMKEIALHTNRQYMRGLVGCISHFTLSTDYHISLVEDAVDGKNINTCGAK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q4VBE4	0.668	0.668	0.000	1017	0.876	0.876	Q4VBE4.pdb.gz	EGFLA_MOUSE Pikachurin OS=Mus musculus OX=10090 GN=Egflam PE=1 SV=1
2	AFDB:Q63HQ2	1.000	1.000	0.000	1017	1.000	1.000	Q63HQ2.pdb.gz	EGFLA_HUMAN Pikachurin OS=Homo sapiens OX=9606 GN=EGFLAM PE=1 SV=2
3	AFDB:P31696	0.247	0.130	4.893E-63	2081	0.222	0.109	P31696.pdb.gz	AGRIN_CHICK Agrin OS=Gallus gallus OX=9031 GN=AGRN PE=1 SV=3
4	AFDB:A1ZA87	0.237	0.181	5.257E-62	1361	0.253	0.189	A1ZA87.pdb.gz	A1ZA87_DROME SP2353, isoform A OS=Drosophila melanogaster OX=7227 GN=SP2353 PE=4 SV=1
5	AFDB:O00468	0.252	0.141	1.057E-61	2068	0.263	0.129	O00468.pdb.gz	AGRIN_HUMAN Agrin OS=Homo sapiens OX=9606 GN=AGRN PE=1 SV=6
6	AFDB:P25304	0.280	0.158	1.084E-60	1959	0.224	0.116	P25304.pdb.gz	AGRIN_RAT Agrin OS=Rattus norvegicus OX=10116 GN=Agrn PE=1 SV=2
7	AFDB:Q5EBX5	0.256	0.270	2.234E-59	961	0.208	0.221	Q5EBX5.pdb.gz	Q5EBX5_MOUSE Mini-agrin OS=Mus musculus OX=10090 GN=Agrn PE=2 SV=1
8	AFDB:Q6P9K9	0.159	0.106	4.817E-34	1571	0.185	0.120	Q6P9K9.pdb.gz	NRX3A_MOUSE Neurexin-3 OS=Mus musculus OX=10090 GN=Nrxn3 PE=1 SV=2
9	AFDB:Q9Y4C0	0.152	0.096	2.825E-33	1643	0.133	0.082	Q9Y4C0.pdb.gz	NRX3A_HUMAN Neurexin-3 OS=Homo sapiens OX=9606 GN=NRXN3 PE=1 SV=4
10	AFDB:Q28146	0.163	0.113	1.090E-32	1530	0.179	0.119	Q28146.pdb.gz	NRX1A_BOVIN Neurexin-1 OS=Bos taurus OX=9913 GN=NRXN1 PE=1 SV=1
11	PDB:6pxvA	0.099	0.112	6.809E-10	823	0.044	0.055	6pxvA.pdb.gz
12	PDB:8eyyA	0.098	0.117	1.649E-9	775	0.044	0.058	8eyyA.pdb.gz
13	PDB:8dtlA	0.098	0.126	6.072E-9	741	0.042	0.058	8dtlA.pdb.gz
14	PDB:7u7nC	0.098	0.419	2.822E-8	200	0.034	0.175	7u7nC.pdb.gz
15	PDB:6pyhD	0.098	0.122	1.439E-7	798	0.049	0.063	6pyhD.pdb.gz
16	PDB:7z0lB	0.093	0.235	1.439E-7	370	0.032	0.089	7z0lB.pdb.gz
17	PDB:7bwaA	0.100	0.132	4.400E-7	674	0.046	0.070	7bwaA.pdb.gz
18	PDB:6m5yA	0.116	0.322	1.066E-6	270	0.035	0.133	6m5yA.pdb.gz	Crystal structure and conformational stability of a galectin-1 tandem-repeat mutant with a short linker.
19	PDB:8a7eC	0.118	0.081	2.097E-5	1524	0.028	0.018	8a7eC.pdb.gz	Structure of the proteolytic enzyme PAPP-A with the endogenous inhibitor stanniocalcin-2 reveals its inhibitory mechanism.
20	PDB:7tzcA	0.088	0.035	3.499E-5	4404	0.072	0.017	7tzcA.pdb.gz	A drug and ATP binding site in type 1 ryanodine receptor.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q4VBE4	0.0	1884	1017	0.884	0.884	EGFLA_MOUSE Pikachurin OS=Mus musculus OX=10090 GN=Egflam PE=1 SV=1
2	Q63HQ2	0.0	2106	1017	1.000	1.000	EGFLA_HUMAN Pikachurin OS=Homo sapiens OX=9606 GN=EGFLAM PE=1 SV=2
3	Q5EBX5	2.49e-98	334	961	0.216	0.229	Q5EBX5_MOUSE Mini-agrin OS=Mus musculus OX=10090 GN=Agrn PE=2 SV=1
4	A1ZA87	6.53e-93	325	1361	0.176	0.132	A1ZA87_DROME SP2353, isoform A OS=Drosophila melanogaster OX=7227 GN=SP2353 PE=4 SV=1
5	Q9NGV2	6.60e-93	325	1361	0.176	0.132	Q9NGV2_DROME SP2353 OS=Drosophila melanogaster OX=7227 GN=SP2353 PE=2 SV=1
6	P25304	2.39e-91	323	1959	0.220	0.114	AGRIN_RAT Agrin OS=Rattus norvegicus OX=10116 GN=Agrn PE=1 SV=2
7	P31696	1.75e-90	320	2081	0.234	0.114	AGRIN_CHICK Agrin OS=Gallus gallus OX=9031 GN=AGRN PE=1 SV=3
8	A2ASQ1	4.11e-90	319	1950	0.218	0.114	AGRIN_MOUSE Agrin OS=Mus musculus OX=10090 GN=Agrn PE=1 SV=1
9	Q05793	1.17e-88	315	3707	0.217	0.060	PGBM_MOUSE Basement membrane-specific heparan sulfate proteoglycan core protein OS=Mus musculus OX=10090 GN=Hspg2 PE=1 SV=1
10	A0A0R4IJ40	4.04e-88	313	1926	0.218	0.115	A0A0R4IJ40_DANRE Agrin OS=Danio rerio OX=7955 GN=hm:gc12 PE=1 SV=1
11	B3GQ72	4.91e-88	313	2028	0.218	0.109	B3GQ72_DANRE Agrin OS=Danio rerio OX=7955 GN=wu:fb57e07 PE=1 SV=1
12	O00468	4.49e-87	310	2068	0.235	0.116	AGRIN_HUMAN Agrin OS=Homo sapiens OX=9606 GN=AGRN PE=1 SV=6
13	P98160	4.97e-87	310	4391	0.213	0.049	PGBM_HUMAN Basement membrane-specific heparan sulfate proteoglycan core protein OS=Homo sapiens OX=9606 GN=HSPG2 PE=1 SV=4
14	A0A8I6ASH2	3.86e-86	308	4387	0.207	0.048	A0A8I6ASH2_RAT Heparan sulfate proteoglycan 2 OS=Rattus norvegicus OX=10116 GN=Hspg2 PE=1 SV=1
15	A0A8I6A2S5	3.97e-86	308	4402	0.207	0.048	A0A8I6A2S5_RAT Heparan sulfate proteoglycan 2 OS=Rattus norvegicus OX=10116 GN=Hspg2 PE=1 SV=1
16	D6RJD2	1.33e-72	237	112	0.110	1.000	D6RJD2_HUMAN EGF like, fibronectin type III and laminin G domains (Fragment) OS=Homo sapiens OX=9606 GN=EGFLAM PE=1 SV=1
17	Q9NFS9	1.05e-59	220	708	0.184	0.264	Q9NFS9_DROME Perlecan domain V (Fragment) OS=Drosophila melanogaster OX=7227 GN=trol PE=2 SV=1
18	Q9NEG1	4.03e-58	219	1035	0.184	0.181	Q9NEG1_DROME EG:BACR25B3.11 protein OS=Drosophila melanogaster OX=7227 GN=trol PE=4 SV=1
19	X2JDK9	1.07e-57	220	3805	0.184	0.049	X2JDK9_DROME Terribly reduced optic lobes, isoform AS OS=Drosophila melanogaster OX=7227 GN=trol PE=1 SV=1
20	M9NGK3	1.14e-57	220	3728	0.184	0.050	M9NGK3_DROME Terribly reduced optic lobes, isoform AL OS=Drosophila melanogaster OX=7227 GN=trol PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00008 EGF	1.7e-07	42.7	EGF-like domain
2	PF00041 fn3	4.7e-27	105.5	Fibronectin type III domain
3	PF16794 fn3_4	77	14.7	Fibronectin-III type domain
4	PF12661 hEGF	0.12	24.3	Human growth factor-like EGF
5	PF09294 Interfer-bind	3.3e+02	13.0	Interferon-alpha/beta receptor, fibronectin type III
6	PF00054 Laminin_G_1	1.1e-79	276.5	Laminin G domain
7	PF02210 Laminin_G_2	6.2e-76	264.4	Laminin G domain
8	PF13385 Laminin_G_3	4.7e-07	41.5	Concanavalin A-like lectin/glucanases superfamily
9	PF18105 PGM1_C	1.4e+02	13.5	PGM1 C-terminal domain
10	PF18861 PTP_tm	5.7e+02	12.2	TM proximal of protein tyrosine phosphatase, receptor type J
11	PF16656 Pur_ac_phosph_N	0.0024	29.8	Purple acid Phosphatase, N-terminal domain
12	PF09061 Stirrup	59	15.3	Stirrup

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000346964

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000442600	0.964	Dystroglycan
2	9606.ENSP00000483469	0.791	Probable G-protein coupled receptor 179
3	9606.ENSP00000354923	0.694	Dystrophin
4	9606.ENSP00000429073	0.693	Sodium/potassium-transporting ATPase subunit beta-1-interacting protein 3
5	9606.ENSP00000384582	0.685	G-protein coupled receptor 98
6	9606.ENSP00000361060	0.672	Protein O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1
7	9606.ENSP00000361302	0.670	Protein O-mannosyl-transferase 1
8	9606.ENSP00000261534	0.667	Protein O-mannosyl-transferase 2
9	9606.ENSP00000326570	0.662	Fukutin-related protein
10	9606.ENSP00000223528	0.658	Fukutin
11	9606.ENSP00000354623	0.648	Whirlin
12	9606.ENSP00000363571	0.638	Muscle, skeletal receptor tyrosine-protein kinase
13	9606.ENSP00000296452	0.617	Protein bassoon
14	9606.ENSP00000456548	0.612	Protein ELFN1
15	9606.ENSP00000231188	0.602	Metabotropic glutamate receptor 6
16	9606.ENSP00000336729	0.577	Polypeptide N-acetylgalactosaminyltransferase 16
17	9606.ENSP00000324960	0.569	Calcium-binding protein 4
18	9606.ENSP00000261234	0.560	UDP-D-xylose:ribitol-5-phosphate beta1,4-xylosyltransferase
19	9606.ENSP00000361667	0.560	Dolichol kinase
20	9606.ENSP00000480791	0.560	Fibroblast growth factor 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0005539	0.729	glycosaminoglycan binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0050789	0.977	regulation of biological process
GO:0050794	0.964	regulation of cellular process
GO:0009100	0.937	glycoprotein metabolic process
GO:0071840	0.833	cellular component organization or biogenesis
GO:0016043	0.824	cellular component organization
GO:0036211	0.757	protein modification process
GO:0032501	0.695	multicellular organismal process
GO:0043062	0.663	extracellular structure organization
GO:0006029	0.624	proteoglycan metabolic process
GO:1903510	0.619	mucopolysaccharide metabolic process
GO:0045229	0.583	external encapsulating structure organization
GO:0048518	0.543	positive regulation of biological process
GO:0030198	0.514	extracellular matrix organization
GO:0018149	0.489	peptide cross-linking
GO:0030204	0.487	chondroitin sulfate metabolic process
GO:0048522	0.473	positive regulation of cellular process
GO:0048856	0.459	anatomical structure development
GO:0048731	0.429	system development
GO:0009058	0.339	biosynthetic process
GO:0030155	0.334	regulation of cell adhesion
GO:0007399	0.326	nervous system development
GO:1901576	0.305	organic substance biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071944	0.999	cell periphery
GO:0031012	0.921	extracellular matrix
GO:0062023	0.900	collagen-containing extracellular matrix
GO:0005614	0.874	interstitial matrix
GO:0016020	0.858	membrane
GO:0043226	0.782	organelle
GO:0005622	0.781	intracellular anatomical structure
GO:0043229	0.705	intracellular organelle
GO:0005604	0.523	basement membrane
GO:0043227	0.439	membrane-bounded organelle
GO:0043231	0.393	intracellular membrane-bounded organelle
GO:0005737	0.347	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]