StarFunc result for job id Q63HR2

User Input

>input (1409 residues)
MKSSGPVERLLRALGRRDSSRAASRPRKAEPHSFREKVFRKKPPVCAVCKVTIDGTGVSC
RVCKVATHRKCEAKVTSACQALPPVELRRNTAPVRRIEHLGSTKSLNHSKQRSTLPRSFS
LDPLMERRWDLDLTYVTERILAAAFPARPDEQRHRGHLRELAHVLQSKHRDKYLLFNLSE
KRHDLTRLNPKVQDFGWPELHAPPLDKLCSICKAMETWLSADPQHVVVLYCKGNKGKLGV
IVSAYMHYSKISAGADQALATLTMRKFCEDKVATELQPSQRRYISYFSGLLSGSIRMNSS
PLFLHYVLIPMLPAFEPGTGFQPFLKIYQSMQLVYTSGVYHIAGPGPQQLCISLEPALLL
KGDVMVTCYHKGGRGTDRTLVFRVQFHTCTIHGPQLTFPKDQLDEAWTDERFPFQASVEF
VFSSSPEKIKGSTPRNDPSVSVDYNTTEPAVRWDSYENFNQHHEDSVDGSLTHTRGPLDG
SPYAQVQRPPRQTPPAPSPEPPPPPMLSVSSDSGHSSTLTTEPAAESPGRPPPTAAERQE
LDRLLGGCGVASGGRGAGRETAILDDEEQPTVGGGPHLGVYPGHRPGLSRHCSCRQGYRE
PCGVPNGGYYRPEGTLERRRLAYGGYEGSPQGYAEASMEKRRLCRSLSEGLYPYPPEMGK
PATGDFGYRAPGYREVVILEDPGLPALYPCPACEEKLALPTAALYGLRLEREAGEGWASE
AGKPLLHPVRPGHPLPLLLPACGHHHAPMPDYSCLKPPKAGEEGHEGCSYTMCPEGRYGH
PGYPALVTYSYGGAVPSYCPAYGRVPHSCGSPGEGRGYPSPGAHSPRAGSISPGSPPYPQ
SRKLSYEIPTEEGGDRYPLPGHLASAGPLASAESLEPVSWREGPSGHSTLPRSPRDAPCS
ASSELSGPSTPLHTSSPVQGKESTRRQDTRSPTSAPTQRLSPGEALPPVSQAGTGKAPEL
PSGSGPEPLAPSPVSPTFPPSSPSDWPQERSPGGHSDGASPRSPVPTTLPGLRHAPWQGP
RGPPDSPDGSPLTPVPSQMPWLVASPEPPQSSPTPAFPLAASYDTNGLSQPPLPEKRHLP
GPGQQPGPWGPEQASSPARGISHHVTFAPLLSDNVPQTPEPPTQESQSNVKFVQDTSKFW
YKPHLSRDQAIALLKDKDPGAFLIRDSHSFQGAYGLALKVATPPPSAQPWKGDPVEQLVR
HFLIETGPKGVKIKGCPSEPYFGSLSALVSQHSISPISLPCCLRIPSKDPLEETPEAPVP
TNMSTAADLLRQGAACSVLYLTSVETESLTGPQAVARASSAALSCSPRPTPAVVHFKVSA
QGITLTDNQRKLFFRRHYPVNSITFSSTDPQDRRWTNPDGTTSKIFGFVAKKPGSPWENV
CHLFAELDPDQPAGAIVTFITKVLLGQRK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q63HR2	1.000	1.000	0.000	1409	1.000	1.000	Q63HR2.pdb.gz	TENS2_HUMAN Tensin-2 OS=Homo sapiens OX=9606 GN=TNS2 PE=1 SV=2
2	AFDB:Q04205	0.340	0.282	8.995E-97	1744	0.423	0.342	Q04205.pdb.gz	TENS1_CHICK Tensin-1 OS=Gallus gallus OX=9031 GN=TNS1 PE=1 SV=3
3	AFDB:Q68CZ2	0.238	0.232	2.284E-94	1445	0.384	0.374	Q68CZ2.pdb.gz	TENS3_HUMAN Tensin-3 OS=Homo sapiens OX=9606 GN=TNS3 PE=1 SV=2
4	AFDB:Q9HBL0	0.249	0.205	5.619E-93	1735	0.414	0.336	Q9HBL0.pdb.gz	TENS1_HUMAN Tensin-1 OS=Homo sapiens OX=9606 GN=TNS1 PE=1 SV=3
5	PDB:7jvxA	0.185	0.750	6.150E-21	314	0.060	0.268	7jvxA.pdb.gz
6	PDB:3qwyA	0.062	0.443	7.537E-6	170	0.031	0.253	3qwyA.pdb.gz
7	AFDB:M9PHY7	0.067	0.090	9.024E-6	1021	0.099	0.136	M9PHY7.pdb.gz	M9PHY7_DROME Suppressor of cytokine signaling at 16D, isoform B OS=Drosophila melanogaster OX=7227 GN=Socs16D PE=4 SV=1
8	AFDB:P39061	0.063	0.055	1.471E-5	1774	0.158	0.125	P39061.pdb.gz	COIA1_MOUSE Collagen alpha-1(XVIII) chain OS=Mus musculus OX=10090 GN=Col18a1 PE=1 SV=4
9	AFDB:Q8INJ8	0.063	0.082	1.828E-5	1052	0.097	0.130	Q8INJ8.pdb.gz	Q8INJ8_DROME Tyrosine-protein kinase OS=Drosophila melanogaster OX=7227 GN=Csk PE=3 SV=2
10	AFDB:X2JE74	0.081	0.095	2.037E-5	1170	0.109	0.131	X2JE74.pdb.gz	X2JE74_DROME X11L, isoform F OS=Drosophila melanogaster OX=7227 GN=X11L PE=4 SV=1
11	AFDB:P39060	0.061	0.056	3.908E-5	1754	0.159	0.128	P39060.pdb.gz	COIA1_HUMAN Collagen alpha-1(XVIII) chain OS=Homo sapiens OX=9606 GN=COL18A1 PE=1 SV=5
12	AFDB:Q9W2S5	0.077	0.051	4.126E-5	2139	0.117	0.077	Q9W2S5.pdb.gz	Q9W2S5_DROME X11Lbeta, isoform A OS=Drosophila melanogaster OX=7227 GN=X11Lbeta PE=1 SV=5
13	PDB:1k9aB	0.071	0.192	1.201E-4	441	0.026	0.082	1k9aB.pdb.gz
14	PDB:5bx1A	0.090	0.661	1.339E-4	153	0.012	0.111	5bx1A.pdb.gz	Crystal Structure of PRL-1 complex with compound analogy 3
15	PDB:4gwfA	0.075	0.177	3.191E-4	497	0.033	0.095	4gwfA.pdb.gz
16	PDB:4fl2A	0.063	0.154	4.926E-4	555	0.021	0.052	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
17	PDB:2lqnA	0.063	0.269	5.491E-4	303	0.032	0.149	2lqnA.pdb.gz
18	PDB:4k2rA	0.064	0.153	5.797E-4	551	0.036	0.093	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
19	PDB:3s4oA	0.084	0.571	6.121E-4	163	0.018	0.153	3s4oA.pdb.gz
20	PDB:1griA	0.073	0.407	6.462E-4	211	0.026	0.175	1griA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F7FBH3	0.0	2460	1454	0.884	0.856	F7FBH3_RAT Tensin 2 OS=Rattus norvegicus OX=10116 GN=Tns2 PE=1 SV=1
2	Q63HR2	0.0	2846	1409	1.000	1.000	TENS2_HUMAN Tensin-2 OS=Homo sapiens OX=9606 GN=TNS2 PE=1 SV=2
3	Q8CGB6	0.0	2501	1400	0.900	0.906	TENS2_MOUSE Tensin-2 OS=Mus musculus OX=10090 GN=Tns2 PE=1 SV=1
4	E7ERH1	2.18e-166	520	780	0.194	0.350	E7ERH1_HUMAN Tensin 1 (Fragment) OS=Homo sapiens OX=9606 GN=TNS1 PE=1 SV=1
5	E9PCX8	1.08e-165	533	1249	0.192	0.216	E9PCX8_HUMAN Tensin 3 OS=Homo sapiens OX=9606 GN=TNS3 PE=1 SV=9
6	A0A494C067	1.01e-158	526	1827	0.197	0.152	A0A494C067_HUMAN Tensin 1 (Fragment) OS=Homo sapiens OX=9606 GN=TNS1 PE=1 SV=1
7	Q9HBL0	4.47e-157	521	1839	0.194	0.148	TENS1_HUMAN Tensin-1 OS=Homo sapiens OX=9606 GN=TNS1 PE=1 SV=3
8	A0A2R8Y4T1	7.21e-157	521	1860	0.194	0.147	A0A2R8Y4T1_HUMAN Tensin 1 OS=Homo sapiens OX=9606 GN=TNS1 PE=1 SV=1
9	E9Q0S6	1.32e-156	521	1888	0.191	0.142	TENS1_MOUSE Tensin-1 OS=Mus musculus OX=10090 GN=Tns1 PE=1 SV=1
10	Q04205	1.11e-149	499	1744	0.185	0.150	TENS1_CHICK Tensin-1 OS=Gallus gallus OX=9031 GN=TNS1 PE=1 SV=3
11	E9PGF5	6.70e-147	491	1714	0.175	0.144	E9PGF5_HUMAN Tensin 1 OS=Homo sapiens OX=9606 GN=TNS1 PE=1 SV=1
12	E9PF55	7.50e-147	491	1721	0.175	0.143	E9PF55_HUMAN Tensin 1 OS=Homo sapiens OX=9606 GN=TNS1 PE=1 SV=1
13	Q68CZ2	8.74e-142	472	1445	0.165	0.161	TENS3_HUMAN Tensin-3 OS=Homo sapiens OX=9606 GN=TNS3 PE=1 SV=2
14	Q5SSZ5	1.59e-139	466	1440	0.159	0.156	TENS3_MOUSE Tensin-3 OS=Mus musculus OX=10090 GN=Tns3 PE=1 SV=1
15	H0Y4U1	3.46e-120	398	846	0.135	0.225	H0Y4U1_HUMAN Tensin 1 OS=Homo sapiens OX=9606 GN=TNS1 PE=1 SV=1
16	H2L045	2.10e-83	303	1354	0.110	0.114	TENSH_CAEEL Tensin homolog OS=Caenorhabditis elegans OX=6239 GN=tns-1 PE=1 SV=2
17	Q8IZW8	1.28e-82	289	715	0.109	0.215	TENS4_HUMAN Tensin-4 OS=Homo sapiens OX=9606 GN=TNS4 PE=1 SV=3
18	Q9VHC3	2.62e-73	262	720	0.095	0.186	Q9VHC3_DROME Blistery, isoform A OS=Drosophila melanogaster OX=7227 GN=by PE=2 SV=1
19	Q6TGR7	2.21e-32	134	431	0.060	0.195	Q6TGR7_DANRE Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN OS=Danio rerio OX=7955 GN=wu:fc52g04 PE=2 SV=1
20	Q54MG8	1.85e-31	136	998	0.064	0.090	Q54MG8_DICDI LIM-domain containing phosphatase OS=Dictyostelium discoideum OX=44689 GN=DDB_G0285967 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00130 C1_1	0.012	26.7	Phorbol esters/diacylglycerol binding domain (C1 domain)
2	PF03107 C1_2	2.8e+02	13.2	C1 domain
3	PF08416 PTB	1.2e-36	137.1	Phosphotyrosine-binding domain
4	PF10409 PTEN_C2	8.7e-21	85.5	C2 domain of PTEN tumour-suppressor protein
5	PF00017 SH2	3.2e-06	38.5	SH2 domain
6	PF16744 zf-RING_15	66	15.0	KIAA1045 RING finger
7	PF17120 zf-RING_16	2.3e+02	12.8	RING/Ubox like zinc-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000319756

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000276297	0.992	Rho GTPase-activating protein 7
2	9606.ENSP00000301178	0.952	Tyrosine-protein kinase receptor UFO
3	9606.ENSP00000339191	0.902	Caveolin-1
4	9606.ENSP00000355593	0.795	Disrupted in schizophrenia 1 protein
5	9606.ENSP00000361548	0.702	Thrombopoietin receptor
6	9606.ENSP00000338785	0.691	StAR-related lipid transfer protein 13
7	9606.ENSP00000479256	0.636	TLR4 interactor with leucine rich repeats
8	9606.ENSP00000252602	0.623	Mitochondrial ribosomal protein L34
9	9606.ENSP00000260505	0.608	Tubulin polyglutamylase TTLL7
10	9606.ENSP00000361811	0.605	TP53-target gene 5 protein
11	9606.ENSP00000220003	0.594	Tyrosine-protein kinase CSK
12	9606.ENSP00000426653	0.567	Protein Wnt-8a
13	9606.ENSP00000340677	0.566	Protein Wnt-8b
14	9606.ENSP00000340982	0.562	Sperm-associated antigen 8
15	9606.ENSP00000360035	0.559	Protein phosphatase 1 regulatory subunit 3D
16	9606.ENSP00000290015	0.551	Protein Wnt-9b
17	9606.ENSP00000386289	0.550	PTB domain-containing engulfment adapter protein 1
18	9606.ENSP00000258411	0.533	Protein Wnt-10a
19	9606.ENSP00000380379	0.521	Protein Wnt-5b
20	9606.ENSP00000316029	0.518	Talin-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0016791	0.999	phosphatase activity
GO:0140096	0.984	catalytic activity, acting on a protein
GO:0019899	0.982	enzyme binding
GO:0004721	0.961	phosphoprotein phosphatase activity
GO:0004725	0.939	protein tyrosine phosphatase activity
GO:0042802	0.922	identical protein binding
GO:0019900	0.904	kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0050789	0.985	regulation of biological process
GO:0008152	0.984	metabolic process
GO:0050794	0.981	regulation of cellular process
GO:0071704	0.940	organic substance metabolic process
GO:0044237	0.939	cellular metabolic process
GO:0048583	0.923	regulation of response to stimulus
GO:0009966	0.911	regulation of signal transduction
GO:0048519	0.898	negative regulation of biological process
GO:0048523	0.886	negative regulation of cellular process
GO:0044238	0.819	primary metabolic process
GO:0050896	0.746	response to stimulus
GO:0006807	0.574	nitrogen compound metabolic process
GO:0032502	0.572	developmental process
GO:0032501	0.571	multicellular organismal process
GO:0019538	0.553	protein metabolic process
GO:0048856	0.520	anatomical structure development
GO:0042127	0.448	regulation of cell population proliferation
GO:0006796	0.435	phosphate-containing compound metabolic process
GO:0007275	0.381	multicellular organism development
GO:0036211	0.347	protein modification process
GO:0023057	0.325	negative regulation of signaling
GO:0010648	0.325	negative regulation of cell communication
GO:0048522	0.317	positive regulation of cellular process
GO:0009968	0.317	negative regulation of signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0030054	1.000	cell junction
GO:0070161	0.983	anchoring junction
GO:0016020	0.880	membrane
GO:0005737	0.808	cytoplasm
GO:0043226	0.807	organelle
GO:0030055	0.792	cell-substrate junction
GO:0043227	0.769	membrane-bounded organelle
GO:0043229	0.717	intracellular organelle
GO:0005925	0.711	focal adhesion
GO:0043231	0.648	intracellular membrane-bounded organelle
GO:0071944	0.624	cell periphery
GO:0005886	0.464	plasma membrane
GO:0005829	0.445	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.3.-	0.999	Phosphoric monoester hydrolases.
RHEA:10684	0.939	H2O + O-phospho-L-tyrosyl-[protein] = L-tyrosyl-[protein] + phosphate
EC:3.1.3.48	0.939	protein-tyrosine-phosphatase.

[back to server]