StarFunc result for job id Q63ZY3

User Input

>input (851 residues)
MAQVLHVPAPFPGTPGPASPPAFPAKDPDPPYSVETPYGYRLDLDFLKYVDDIEKGHTLR
RVAVQRRPRLSSLPRGPGSWWTSTESLCSNASGDSRHSAYSYCGRGFYPQYGALETRGGF
NPRVERTLLDARRRLEDQAATPTGLGSLTPSAAGSTASLVGVGLPPPTPRSSGLSTPVPP
SAGHLAHVREQMAGALRKLRQLEEQVKLIPVLQVKLSVLQEEKRQLTVQLKSQKFLGHPT
AGRGRSELCLDLPDPPEDPVALETRSVGTWVRERDLGMPDGEAALAAKVAVLETQLKKAL
QELQAAQARQADPQPQAWPPPDSPVRVDTVRVVEGPREVEVVASTAAGAPAQRAQSLEPY
GTGLRALAMPGRPESPPVFRSQEVVETMCPVPAAATSNVHMVKKISITERSCDGAAGLPE
VPAESSSSPPGSEVASLTQPEKSTGRVPTQEPTHREPTRQAASQESEEAGGTGGPPAGVR
SIMKRKEEVADPTAHRRSLQFVGVNGGYESSSEDSSTAENISDNDSTENEAPEPRERVPS
VAEAPQLRPAGTAAAKTSRQECQLSRESQHIPTAEGASGSNTEEEIRMELSPDLISACLA
LEKYLDNPNALTERELKVAYTTVLQEWLRLACRSDAHPELVRRHLVTFRAMSARLLDYVV
NIADSNGNTALHYSVSHANFPVVQQLLDSGVCKVDKQNRAGYSPIMLTALATLKTQDDIE
TVLQLFRLGNINAKASQAGQTALMLAVSHGRVDVVKALLACEADVNVQDDDGSTALMCAC
EHGHKEIAGLLLAVPSCDISLTDRDGSTALMVALDAGQSEIASMLYSRMNIKCSFAPMSD
DESPTSSSAEE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q63ZY3	1.000	1.000	7.541E-98	851	1.000	1.000	Q63ZY3.pdb.gz	KANK2_HUMAN KN motif and ankyrin repeat domain-containing protein 2 OS=Homo sapiens OX=9606 GN=KANK2 PE=1 SV=1
2	AFDB:D3ZD05	0.342	0.344	1.346E-81	847	0.828	0.832	D3ZD05.pdb.gz	KANK2_RAT KN motif and ankyrin repeat domain-containing protein 2 OS=Rattus norvegicus OX=10116 GN=Kank2 PE=1 SV=2
3	AFDB:X1WE18	0.308	0.244	4.877E-47	1085	0.486	0.382	X1WE18.pdb.gz	KANK2_DANRE KN motif and ankyrin repeat domain-containing protein 2 OS=Danio rerio OX=7955 GN=kank2 PE=3 SV=1
4	PDB:8cs9A	0.192	0.205	1.212E-8	796	0.073	0.078	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
5	PDB:1wg0A	0.182	0.568	7.229E-8	243	0.066	0.230	1wg0A.pdb.gz
6	PDB:4oauC	0.150	0.176	1.235E-7	692	0.075	0.092	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
7	PDB:2dvwA	0.195	0.670	1.477E-7	229	0.062	0.231	2dvwA.pdb.gz
8	PDB:1bu9A	0.170	0.812	8.813E-7	168	0.042	0.214	1bu9A.pdb.gz
9	AFDB:Q54HC6	0.202	0.124	1.111E-6	1460	0.152	0.088	Q54HC6.pdb.gz	ARKA_DICDI Ankyrin repeat-containing protein kinase A OS=Dictyostelium discoideum OX=44689 GN=arkA PE=1 SV=1
10	PDB:6jd6B	0.183	0.734	1.506E-6	192	0.051	0.224	6jd6B.pdb.gz
11	PDB:1bd8A	0.166	0.818	1.801E-6	156	0.046	0.250	1bd8A.pdb.gz
12	PDB:5vkqA	0.171	0.107	7.516E-6	1499	0.069	0.039	5vkqA.pdb.gz
13	PDB:6pqpA	0.170	0.232	3.138E-5	615	0.048	0.067	6pqpA.pdb.gz	Structural Insights into Electrophile Irritant Sensing by the Human TRPA1 Channel.
14	PDB:6v9hC	0.180	0.527	3.138E-5	270	0.041	0.130	6v9hC.pdb.gz
15	AFDB:A0A3B3IRZ4	0.067	0.054	3.618E-5	1222	0.136	0.095	A0A3B3IRZ4.pdb.gz	A0A3B3IRZ4_HUMAN IQ motif and Sec7 domain ArfGEF 1 OS=Homo sapiens OX=9606 GN=IQSEC1 PE=1 SV=1
16	AFDB:Q54GR0	0.128	0.111	2.257E-4	1036	0.133	0.109	Q54GR0.pdb.gz	Q54GR0_DICDI Uncharacterized protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0289987 PE=4 SV=1
17	AFDB:Q8CGN4	0.157	0.084	3.374E-4	1759	0.174	0.084	Q8CGN4.pdb.gz	BCOR_MOUSE BCL-6 corepressor OS=Mus musculus OX=10090 GN=Bcor PE=1 SV=2
18	AFDB:Q6W2J9	0.141	0.074	3.857E-4	1755	0.152	0.074	Q6W2J9.pdb.gz	BCOR_HUMAN BCL-6 corepressor OS=Homo sapiens OX=9606 GN=BCOR PE=1 SV=1
19	AFDB:D3ZU00	0.079	0.094	8.617E-4	654	0.132	0.171	D3ZU00.pdb.gz	D3ZU00_RAT Prospero homeobox 1 OS=Rattus norvegicus OX=10116 GN=Prox1 PE=1 SV=3
20	AFDB:F4K0Y5	0.079	0.063	2.201E-3	1165	0.147	0.107	F4K0Y5.pdb.gz	F4K0Y5_ARATH Heat shock protein DnaJ with tetratricopeptide repeat-containing protein OS=Arabidopsis thaliana OX=3702 GN=TPR16 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D3ZD05	0.0	1349	847	0.827	0.831	KANK2_RAT KN motif and ankyrin repeat domain-containing protein 2 OS=Rattus norvegicus OX=10116 GN=Kank2 PE=1 SV=2
2	Q63ZY3	0.0	1728	851	1.000	1.000	KANK2_HUMAN KN motif and ankyrin repeat domain-containing protein 2 OS=Homo sapiens OX=9606 GN=KANK2 PE=1 SV=1
3	Q8BX02	0.0	1359	843	0.831	0.839	KANK2_MOUSE KN motif and ankyrin repeat domain-containing protein 2 OS=Mus musculus OX=10090 GN=Kank2 PE=1 SV=1
4	X1WE18	3.41e-102	343	1085	0.288	0.226	KANK2_DANRE KN motif and ankyrin repeat domain-containing protein 2 OS=Danio rerio OX=7955 GN=kank2 PE=3 SV=1
5	Q14678	8.79e-91	315	1352	0.216	0.136	KANK1_HUMAN KN motif and ankyrin repeat domain-containing protein 1 OS=Homo sapiens OX=9606 GN=KANK1 PE=1 SV=3
6	Q5T7N3	9.20e-80	280	995	0.180	0.154	KANK4_HUMAN KN motif and ankyrin repeat domain-containing protein 4 OS=Homo sapiens OX=9606 GN=KANK4 PE=1 SV=1
7	G5EDN8	2.02e-60	224	1040	0.140	0.114	G5EDN8_CAEEL ANK_REP_REGION domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=vab-19 PE=1 SV=1
8	A0A0B4JD77	5.11e-59	210	446	0.119	0.226	A0A0B4JD77_DROME Kank, isoform J OS=Drosophila melanogaster OX=7227 GN=Kank PE=4 SV=1
9	A1Z9W7	7.53e-57	214	1042	0.119	0.097	A1Z9W7_DROME Kank, isoform B OS=Drosophila melanogaster OX=7227 GN=Kank PE=4 SV=1
10	A0A0B4JD54	7.71e-57	214	1063	0.119	0.095	A0A0B4JD54_DROME Kank, isoform F OS=Drosophila melanogaster OX=7227 GN=Kank PE=4 SV=1
11	A0A0B4KF63	8.22e-57	214	1039	0.119	0.097	A0A0B4KF63_DROME Kank, isoform I OS=Drosophila melanogaster OX=7227 GN=Kank PE=4 SV=1
12	A0A0B4JCT6	1.29e-56	214	1294	0.119	0.078	A0A0B4JCT6_DROME Kank, isoform G OS=Drosophila melanogaster OX=7227 GN=Kank PE=4 SV=1
13	Q7KMM8	1.32e-56	214	1224	0.119	0.083	Q7KMM8_DROME BcDNA.GH03482 OS=Drosophila melanogaster OX=7227 GN=Kank PE=2 SV=1
14	A8DYE0	1.65e-56	214	1339	0.119	0.075	A8DYE0_DROME Kank, isoform D OS=Drosophila melanogaster OX=7227 GN=Kank PE=2 SV=1
15	A1Z9W5	1.80e-56	213	1301	0.119	0.078	A1Z9W5_DROME Kank, isoform C OS=Drosophila melanogaster OX=7227 GN=Kank PE=4 SV=1
16	Q5BIA1	1.94e-56	213	1301	0.119	0.078	Q5BIA1_DROME RE07880p OS=Drosophila melanogaster OX=7227 GN=Kank PE=2 SV=1
17	E1JH70	1.80e-25	115	934	0.062	0.057	E1JH70_DROME Kank, isoform E OS=Drosophila melanogaster OX=7227 GN=Kank PE=4 SV=1
18	E9QEX9	2.54e-14	80.1	2607	0.067	0.022	E9QEX9_DANRE Ankyrin repeat and KH domain-containing 1 OS=Danio rerio OX=7955 GN=ankhd1 PE=1 SV=1
19	A0A0R4IUB2	2.64e-14	80.1	2580	0.067	0.022	A0A0R4IUB2_DANRE Ankyrin repeat and KH domain-containing 1 OS=Danio rerio OX=7955 GN=ankhd1 PE=1 SV=2
20	A0A0G2K916	1.04e-13	78.2	2615	0.067	0.022	A0A0G2K916_RAT Eukaryotic translation initiation factor 4E binding protein 3 OS=Rattus norvegicus OX=10116 GN=Ankhd1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	3.7e-17	73.1	Ankyrin repeat
2	PF12796 Ank_2	3.3e-21	87.0	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	9.5e-17	70.2	Ankyrin repeat
4	PF13637 Ank_4	5.9e-15	66.7	Ankyrin repeats (many copies)
5	PF13857 Ank_5	1.2e-12	59.1	Ankyrin repeats (many copies)
6	PF12075 KN_motif	2.1e-19	80.3	KN motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000468002

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000354878	0.956	Kinesin-like protein KIF21A
2	9606.ENSP00000269321	0.789	Rho GDP-dissociation inhibitor 1
3	9606.ENSP00000294618	0.722	Dedicator of cytokinesis protein 6
4	9606.ENSP00000314724	0.671	Liprin-beta-1
5	9606.ENSP00000346954	0.633	Transmembrane protein 205
6	9606.ENSP00000372482	0.632	Small nuclear ribonucleoprotein U11/U12 subunit 25
7	9606.ENSP00000483814	0.624	GATOR complex protein NPRL3
8	9606.ENSP00000262370	0.600	E3 ubiquitin-protein ligase MGRN1
9	9606.ENSP00000322775	0.593	Inactive rhomboid protein 2
10	9606.ENSP00000465075	0.587	Kinetochore protein Spc24
11	9606.ENSP00000262316	0.573	Inactive rhomboid protein 1
12	9606.ENSP00000376297	0.569	Dynein light chain 1, cytoplasmic
13	9606.ENSP00000310008	0.568	ATPase SWSAP1
14	9606.ENSP00000315118	0.557	Atypical kinase COQ8B, mitochondrial
15	9606.ENSP00000378611	0.552	Rho GTPase-activating protein 24
16	9606.ENSP00000287295	0.551	Apoptosis-inducing factor 1, mitochondrial
17	9606.ENSP00000378165	0.532	BUB3-interacting and GLEBS motif-containing protein ZNF207
18	9606.ENSP00000323687	0.525	(E3-independent) E2 ubiquitin-conjugating enzyme
19	9606.ENSP00000250615	0.524	Serotonin N-acetyltransferase
20	9606.ENSP00000416683	0.523	Insulin-like growth factor-binding protein complex acid labile subunit

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0050794	0.995	regulation of cellular process
GO:0023051	0.944	regulation of signaling
GO:0010646	0.940	regulation of cell communication
GO:0032501	0.929	multicellular organismal process
GO:0048583	0.910	regulation of response to stimulus
GO:0009966	0.878	regulation of signal transduction
GO:0035023	0.865	regulation of Rho protein signal transduction
GO:0010631	0.845	epithelial cell migration
GO:0048519	0.792	negative regulation of biological process
GO:0048523	0.712	negative regulation of cellular process
GO:0019222	0.539	regulation of metabolic process
GO:0080090	0.442	regulation of primary metabolic process
GO:0060255	0.437	regulation of macromolecule metabolic process
GO:0032502	0.433	developmental process
GO:0051171	0.433	regulation of nitrogen compound metabolic process
GO:0048856	0.413	anatomical structure development
GO:0048518	0.324	positive regulation of biological process
GO:0031323	0.309	regulation of cellular metabolic process
GO:0007275	0.307	multicellular organism development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0005829	0.937	cytosol
GO:0016020	0.838	membrane
GO:0005739	0.827	mitochondrion
GO:0071944	0.456	cell periphery
GO:0005886	0.438	plasma membrane
GO:0005634	0.396	nucleus
GO:0043232	0.355	intracellular non-membrane-bounded organelle
GO:0030054	0.321	cell junction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]