StarFunc result for job id Q641Q2

User Input

>input (1341 residues)
MMNRTTPDQELAPASEPVWERPWSVEEIRRSSQSWSLAADAGLLQFLQEFSQQTISRTHE
IKKQVDGLIRETKATDCRLHNVFNDFLMLSNTQFIENRVYDEEVEEPVLKAEAEKTEQEK
TREQKEVDLIPKVQEAVNYGLQVLDSAFEQLDIKAGNSDSEEDDANGRVELILEPKDLYI
DRPLPYLIGSKLFMEQEDVGLGELSSEEGSVGSDRGSIVDTEEEKEEEESDEDFAHHSDN
EQNRHTTQMSDEEEDDDGCDLFADSEKEEEDIEDIEENTRPKRSRPTSFADELAARIKGD
AVGRVDEEPTTLPSGEAKPRKTLKEKKERRTPSDDEEDNLFAPPKLTDEDFSPFGSGGGL
FSGGKGLFDDEDEESDLFTEAPQDRQAGASVKEESSSSKPGKKIPAGAVSVFLGDTDVFG
AASVPSMKEPQKPEQPTPRKSPYGPPPTGLFDDDDGDDDDDFFSAPHSKPSKTGKVQSTA
DIFGDEEGDLFKEKAVASPEATVSQTDENKARAEKKVTLSSSKNLKPSSETKTQKGLFSD
EEDSEDLFSSQSASKLKGASLLPGKLPTLVSLFDDEDEEDNLFGGTAAKKQTLCLQAQRE
EKAKASELSKKKASALLFSSDEEDQWNIPASQTHLASDSRSKGEPRDSGTLQSQEAKAVK
KTSLFEEDEEDDLFAIAKDSQKKTQRVSLLFEDDVDSGGSLFGSPPTSVPPATKKKETVS
EAPPLLFSDEEEKEAQLGVKSVDKKVESAKESLKFGRTDVAESEKEGLLTRSAQETVKHS
DLFSSSSPWDKGTKPRTKTVLSLFDEEEDKMEDQNIIQAPQKEVGKGRDPDAHPKSTGVF
QDEELLFSHKLQKDNDPDVDLFAGTKKTKLLEPSVGSLFGDDEDDDLFSSAKSQPLVQEK
KRVVKKDHSVDSFKNQKHPESIQGSKEKGIWKPETPQDSSGLAPFKTKEPSTRIGKIQAN
LAINPAALLPTAASQISEVKPVLPELAFPSSEHRRSHGLESVPVLPGSGEAGVSFDLPAQ
ADTLHSANKSRVKMRGKRRPQTRAARRLAAQESSETEDMSVPRGPIAQWADGAISPNGHR
PQLRAASGEDSTEEALAAAAAPWEGGPVPGVDRSPFAKSLGHSRGEADLFDSGDIFSTGT
GSQSVERTKPKAKIAENPANPPVGGKAKSPMFPALGEASSDDDLFQSAKPKPAKKTNPFP
LLEDEDDLFTDQKVKKNETKSNSQQDVILTTQDIFEDDIFATEAIKPSQKTREKEKTLES
NLFDDNIDIFADLTVKPKEKSKKKVEAKSIFDDDMDDIFSSGIQAKTTKPKSRSAQAAPE
PRFEHKVSNIFDDPLNAFGGQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A087WYF6	0.097	0.103	0.000	1245	0.926	0.998	A0A087WYF6.pdb.gz	A0A087WYF6_HUMAN WASH complex subunit 2A OS=Homo sapiens OX=9606 GN=WASHC2A PE=1 SV=1
2	AFDB:E7ESD2	0.110	0.113	0.000	1279	0.952	0.998	E7ESD2.pdb.gz	E7ESD2_HUMAN WASH complex subunit 2A OS=Homo sapiens OX=9606 GN=WASHC2A PE=1 SV=2
3	AFDB:Q641Q2	0.999	0.999	0.000	1341	1.000	1.000	Q641Q2.pdb.gz	WAC2A_HUMAN WASH complex subunit 2A OS=Homo sapiens OX=9606 GN=WASHC2A PE=1 SV=3
4	AFDB:Q6PGL7	0.158	0.159	0.000	1334	0.740	0.744	Q6PGL7.pdb.gz	WASC2_MOUSE WASH complex subunit 2 OS=Mus musculus OX=10090 GN=Washc2 PE=1 SV=1
5	AFDB:Q9Y4E1	0.172	0.174	0.000	1320	0.970	0.986	Q9Y4E1.pdb.gz	WAC2C_HUMAN WASH complex subunit 2C OS=Homo sapiens OX=9606 GN=WASHC2C PE=1 SV=5
6	AFDB:A1ZBW7	0.064	0.060	2.244E-16	1469	0.226	0.206	A1ZBW7.pdb.gz	WASC2_DROME WASH complex subunit 2 OS=Drosophila melanogaster OX=7227 GN=FAM21 PE=1 SV=1
7	AFDB:Q552E2	0.065	0.060	1.128E-11	1479	0.220	0.199	Q552E2.pdb.gz	WASC2_DICDI WASH complex subunit 2 OS=Dictyostelium discoideum OX=44689 GN=washc2 PE=1 SV=1
8	AFDB:Q585V1	0.057	0.099	7.566E-4	713	0.114	0.215	Q585V1.pdb.gz	Q585V1_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=30J2.50 PE=4 SV=1
9	AFDB:B1AR09	0.034	0.034	4.793E-2	1079	0.126	0.157	B1AR09.pdb.gz	B1AR09_MOUSE Myeloid/lymphoid or mixed-lineage leukemia; translocated to, 6 OS=Mus musculus OX=10090 GN=Mllt6 PE=1 SV=1
10	AFDB:B1AR10	0.035	0.041	5.114E-2	1109	0.133	0.161	B1AR10.pdb.gz	B1AR10_MOUSE Myeloid/lymphoid or mixed-lineage leukemia; translocated to, 6 OS=Mus musculus OX=10090 GN=Mllt6 PE=1 SV=1
11	PDB:6qlfQ	0.046	0.242	2.320	204	0.015	0.098	6qlfQ.pdb.gz
12	PDB:7nacw	0.027	0.052	4.158	672	0.023	0.046	7nacw.pdb.gz	Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.
13	PDB:5n9jG	0.042	0.259	8.482	163	0.009	0.074	5n9jG.pdb.gz
14	PDB:7d5sA5	0.033	0.076	9.050	514	0.013	0.035	7d5sA5.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state A2)
15	PDB:7v2wI	0.034	0.148	9.050	240	0.015	0.083	7v2wI.pdb.gz
16	PDB:3c98B	0.024	0.111	9.656	230	0.011	0.065	3c98B.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A087WYF6	0.0	2437	1245	0.926	0.998	A0A087WYF6_HUMAN WASH complex subunit 2A OS=Homo sapiens OX=9606 GN=WASHC2A PE=1 SV=1
2	E7ESD2	0.0	1781	1279	0.668	0.701	E7ESD2_HUMAN WASH complex subunit 2A OS=Homo sapiens OX=9606 GN=WASHC2A PE=1 SV=2
3	F8W7U3	0.0	2469	1253	0.928	0.993	F8W7U3_HUMAN WASH complex subunit 2A OS=Homo sapiens OX=9606 GN=WASHC2A PE=1 SV=1
4	J3KP36	0.0	2392	1262	0.918	0.975	J3KP36_HUMAN WASH complex subunit 2C OS=Homo sapiens OX=9606 GN=WASHC2C PE=1 SV=3
5	Q641Q2	0.0	2678	1341	1.000	1.000	WAC2A_HUMAN WASH complex subunit 2A OS=Homo sapiens OX=9606 GN=WASHC2A PE=1 SV=3
6	Q6PGL7	0.0	1672	1334	0.738	0.741	WASC2_MOUSE WASH complex subunit 2 OS=Mus musculus OX=10090 GN=Washc2 PE=1 SV=1
7	Q9Y4E1	0.0	2587	1320	0.972	0.987	WAC2C_HUMAN WASH complex subunit 2C OS=Homo sapiens OX=9606 GN=WASHC2C PE=1 SV=5
8	A0A0A0MT65	3.80e-163	491	279	0.195	0.939	A0A0A0MT65_HUMAN WASH complex subunit 2C (Fragment) OS=Homo sapiens OX=9606 GN=WASHC2C PE=1 SV=1
9	Q552E2	1.89e-30	133	1479	0.051	0.047	WASC2_DICDI WASH complex subunit 2 OS=Dictyostelium discoideum OX=44689 GN=washc2 PE=1 SV=1
10	Q585V1	5.27e-08	60.1	713	0.028	0.053	Q585V1_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=30J2.50 PE=4 SV=1
11	A1ZBW7	2.34e-07	58.2	1469	0.034	0.031	WASC2_DROME WASH complex subunit 2 OS=Drosophila melanogaster OX=7227 GN=FAM21 PE=1 SV=1
12	Q0P484	0.003	43.9	305	0.031	0.134	Q0P484_DANRE CapZ-interacting protein OS=Danio rerio OX=7955 GN=zgc:153303 PE=2 SV=1
13	F1M4V3	0.14	38.5	408	0.025	0.083	F1M4V3_RAT RCSD domain containing 1 OS=Rattus norvegicus OX=10116 GN=Rcsd1 PE=1 SV=3
14	Q6JBY9	0.29	37.7	416	0.025	0.082	CPZIP_HUMAN CapZ-interacting protein OS=Homo sapiens OX=9606 GN=RCSD1 PE=1 SV=1
15	Q64FF8	0.50	37.0	404	0.023	0.077	Q64FF8_DANRE Aryl hydrocarbon receptor nuclear translocator isoform b OS=Danio rerio OX=7955 GN=zgc:136664 PE=2 SV=1
16	Q1JPT1	0.58	36.6	440	0.023	0.070	Q1JPT1_DANRE Aryl hydrocarbon receptor nuclear translocator OS=Danio rerio OX=7955 GN=zgc:136664 PE=2 SV=1
17	Q64FF9	2.4	35.0	503	0.023	0.062	Q64FF9_DANRE Aryl hydrocarbon receptor nuclear translocator OS=Danio rerio OX=7955 GN=zgc:136664 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15255 CAP-ZIP_m	9.3e-60	212.5	WASH complex subunit CAP-Z interacting, central region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000282633

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000240079	0.996	WASH complex subunit 3
2	9606.ENSP00000318016	0.996	WASH complex subunit 5
3	9606.ENSP00000484713	0.990	WASH complex subunit 4
4	9606.ENSP00000485627	0.983	WASH complex subunit 1
5	9606.ENSP00000401010	0.851	F-actin-capping protein subunit beta
6	9606.ENSP00000263168	0.831	F-actin-capping protein subunit alpha-1
7	9606.ENSP00000363482	0.831	WASH complex subunit 2C
8	9606.ENSP00000299138	0.792	Vacuolar protein sorting-associated protein 35
9	9606.ENSP00000317542	0.720	Putative WAS protein family homolog 4
10	9606.ENSP00000485442	0.720	Acts as a nucleation-promoting factor at the surface of endosomes, where it recruits and activates the Arp2/3 complex to induce actin polymerization, playing a key role in the fission of tubules that serve as transport intermediates during endosome sorting. Involved in endocytic trafficking of EGF. Its assembly in the WASH core complex seems to inhibit its NPF activity and via WASHC2 is required for its membrane targeting. Involved in transferrin receptor recycling. Regulates the trafficking of endosomal alpha5beta1 integrin to the plasma membrane and involved in invasive cell migratio [...]
11	9606.ENSP00000354947	0.671	F-actin-capping protein subunit alpha-2
12	9606.ENSP00000480853	0.670	Vacuolar protein sorting-associated protein 29
13	9606.ENSP00000238256	0.662	FK506-binding protein 15
14	9606.ENSP00000402935	0.629	TBC1 domain family member 5
15	9606.ENSP00000365477	0.611	Coiled-coil domain-containing protein 93
16	9606.ENSP00000357836	0.603	Sorting nexin-27
17	9606.ENSP00000365401	0.603	Coiled-coil domain-containing protein 22
18	9606.ENSP00000260818	0.601	DnaJ homolog subfamily C member 13
19	9606.ENSP00000362480	0.595	Vacuolar protein sorting-associated protein 26A
20	9606.ENSP00000377700	0.594	TBC1 domain family member 23

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0051179	0.978	localization
GO:0008104	0.957	protein localization
GO:0006810	0.915	transport
GO:0065007	0.898	biological regulation
GO:0051649	0.883	establishment of localization in cell
GO:0046907	0.871	intracellular transport
GO:0050789	0.857	regulation of biological process
GO:0016192	0.813	vesicle-mediated transport
GO:0050794	0.769	regulation of cellular process
GO:0016043	0.728	cellular component organization
GO:0016197	0.716	endosomal transport
GO:0033365	0.665	protein localization to organelle
GO:0042147	0.650	retrograde transport, endosome to Golgi
GO:0032456	0.610	endocytic recycling
GO:0048522	0.554	positive regulation of cellular process
GO:0051130	0.486	positive regulation of cellular component organization
GO:0048519	0.376	negative regulation of biological process
GO:0048523	0.311	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0005730	0.999	nucleolus
GO:0031982	0.497	vesicle
GO:0097708	0.485	intracellular vesicle
GO:0016020	0.461	membrane
GO:0031410	0.444	cytoplasmic vesicle
GO:0012505	0.406	endomembrane system
GO:0032991	0.358	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]