StarFunc result for job id Q643R3

User Input

>input (524 residues)
MSQGSPGDWAPLDPTPGPPASPNPFVHELHLSRLQRVKFCLLGALLAPIRVLLAFIVLFL
LWPFAWLQVAGLSEEQLQEPITGWRKTVCHNGVLGLSRLLFFLLGFLRIRVRGQRASRLQ
APVLVAAPHSTFFDPIVLLPCDLPKVVSRAENLSVPVIGALLRFNQAILVSRHDPASRRR
VVEEVRRRATSGGKWPQVLFFPEGTCSNKKALLKFKPGAFIAGVPVQPVLIRYPNSLDTT
SWAWRGPGVLKVLWLTASQPCSIVDVEFLPVYHPSPEESRDPTLYANNVQRVMAQALGIP
ATECEFVGSLPVIVVGRLKVALEPQLWELGKVLRKAGLSAGYVDAGAEPGRSRMISQEEF
ARQLQLSDPQTVAGAFGYFQQDTKGLVDFRDVALALAALDGGRSLEELTRLAFELFAEEQ
AEGPNRLLYKDGFSTILHLLLGSPHPAATALHAELCQAGSSQGLSLCQFQNFSLHDPLYG
KLFSTYLRPPHTSRGTSQTPNASSPGNPTALANGTVQAPKQKGD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q643R3	1.000	1.000	8.453E-94	524	1.000	1.000	Q643R3.pdb.gz	LPCT4_HUMAN Lysophospholipid acyltransferase LPCAT4 OS=Homo sapiens OX=9606 GN=LPCAT4 PE=1 SV=1
2	AFDB:Q1HAQ0	0.556	0.546	1.465E-40	534	0.365	0.358	Q1HAQ0.pdb.gz	PCAT1_RAT Lysophosphatidylcholine acyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Lpcat1 PE=1 SV=2
3	AFDB:Q7L5N7	0.545	0.526	1.621E-40	544	0.393	0.379	Q7L5N7.pdb.gz	PCAT2_HUMAN Lysophosphatidylcholine acyltransferase 2 OS=Homo sapiens OX=9606 GN=LPCAT2 PE=1 SV=1
4	AFDB:Q8NF37	0.549	0.539	2.628E-39	534	0.342	0.335	Q8NF37.pdb.gz	PCAT1_HUMAN Lysophosphatidylcholine acyltransferase 1 OS=Homo sapiens OX=9606 GN=LPCAT1 PE=1 SV=2
5	AFDB:Q8BYI6	0.542	0.523	6.219E-39	544	0.370	0.357	Q8BYI6.pdb.gz	PCAT2_MOUSE Lysophosphatidylcholine acyltransferase 2 OS=Mus musculus OX=10090 GN=Lpcat2 PE=1 SV=1
6	AFDB:Q0KHU5	0.546	0.537	1.852E-37	533	0.302	0.296	Q0KHU5.pdb.gz	PCAT_DROME Lysophosphatidylcholine acyltransferase OS=Drosophila melanogaster OX=7227 GN=LPCAT PE=2 SV=1
7	AFDB:A0A060X5E8	0.546	0.713	5.267E-34	398	0.263	0.347	A0A060X5E8.pdb.gz	A0A060X5E8_ONCMY Phospholipid/glycerol acyltransferase domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00020502001 PE=3 SV=1
8	AFDB:Q8S8S2	0.518	0.505	2.384E-26	539	0.216	0.210	Q8S8S2.pdb.gz	LPCT2_ARATH Lysophospholipid acyltransferase LPEAT2 OS=Arabidopsis thaliana OX=3702 GN=LPEAT2 PE=1 SV=1
9	AFDB:Q8L7R3	0.477	0.621	2.749E-19	398	0.158	0.209	Q8L7R3.pdb.gz	LPCT1_ARATH Lysophospholipid acyltransferase LPEAT1 OS=Arabidopsis thaliana OX=3702 GN=LPEAT1 PE=1 SV=1
10	AFDB:Q38BL2	0.420	0.303	3.641E-18	761	0.223	0.154	Q38BL2.pdb.gz	Q38BL2_TRYB2 Phospholipid/glycerol acyltransferase domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.3450 PE=4 SV=1
11	PDB:2ct9B	0.141	0.290	9.974E-3	198	0.063	0.167	2ct9B.pdb.gz	Structural characterization of calcineurin B homologous protein 1
12	PDB:5f2tB	0.188	0.329	3.539E-2	262	0.071	0.141	5f2tB.pdb.gz	Structural basis for selective recognition of acyl chains by the membrane-associated acyltransferase PatA.
13	PDB:2l2eA	0.205	0.495	5.307E-2	189	0.065	0.180	2l2eA.pdb.gz
14	PDB:7u0tA	0.140	0.288	5.307E-2	190	0.059	0.163	7u0tA.pdb.gz	Structure-Guided Synthesis of FK506 and FK520 Analogs with Increased Selectivity Exhibit In Vivo Therapeutic Efficacy against Cryptococcus.
15	PDB:6ya9A	0.117	0.143	5.873E-2	400	0.050	0.065	6ya9A.pdb.gz	Genetically encoded photo-switchable molecular sensors for optoacoustic and super-resolution imaging.
16	PDB:1fpwA	0.156	0.361	6.178E-2	190	0.063	0.174	1fpwA.pdb.gz	Structure and calcium-binding properties of Frq1, a novel calcium sensor in the yeast Saccharomyces cerevisiae.
17	PDB:6hr1A	0.117	0.144	9.265E-2	406	0.050	0.064	6hr1A.pdb.gz	Chimeric single alpha-helical domains as rigid fusion protein connections for protein nanotechnology and structural biology.
18	PDB:7nmiB	0.110	0.117	1.194E-1	488	0.044	0.047	7nmiB.pdb.gz	Transactivation domain of p53 in complex with S100P using annexin A2 as a crystallization chaperone
19	PDB:1v1fA	0.147	0.328	1.321E-1	188	0.050	0.138	1v1fA.pdb.gz	The Structure of the Arabidopsis Thaliana SOS3: Molecular Mechanism of Sensing Calcium for Salt Stress Response
20	PDB:5d43A	0.102	0.297	1.321E-1	150	0.036	0.127	5d43A.pdb.gz	Crystal Structure of Wild-Type Centrin 1 from Mus musculus Occupied by Ca2.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q643R3	0.0	1056	524	1.000	1.000	LPCT4_HUMAN Lysophospholipid acyltransferase LPCAT4 OS=Homo sapiens OX=9606 GN=LPCAT4 PE=1 SV=1
2	Q6NVG1	0.0	923	524	0.933	0.933	LPCT4_MOUSE Lysophospholipid acyltransferase LPCAT4 OS=Mus musculus OX=10090 GN=Lpcat4 PE=1 SV=1
3	Q7L5N7	1.05e-116	357	544	0.384	0.369	PCAT2_HUMAN Lysophosphatidylcholine acyltransferase 2 OS=Homo sapiens OX=9606 GN=LPCAT2 PE=1 SV=1
4	Q8BYI6	2.14e-115	353	544	0.368	0.355	PCAT2_MOUSE Lysophosphatidylcholine acyltransferase 2 OS=Mus musculus OX=10090 GN=Lpcat2 PE=1 SV=1
5	Q3TFD2	7.92e-106	328	534	0.355	0.348	PCAT1_MOUSE Lysophosphatidylcholine acyltransferase 1 OS=Mus musculus OX=10090 GN=Lpcat1 PE=1 SV=1
6	Q1HAQ0	9.71e-106	328	534	0.355	0.348	PCAT1_RAT Lysophosphatidylcholine acyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Lpcat1 PE=1 SV=2
7	Q8NF37	6.09e-102	318	534	0.345	0.339	PCAT1_HUMAN Lysophosphatidylcholine acyltransferase 1 OS=Homo sapiens OX=9606 GN=LPCAT1 PE=1 SV=2
8	A0A060X5E8	2.05e-91	286	398	0.265	0.349	A0A060X5E8_ONCMY Phospholipid/glycerol acyltransferase domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00020502001 PE=3 SV=1
9	Q0KHU5	3.84e-85	275	533	0.261	0.257	PCAT_DROME Lysophosphatidylcholine acyltransferase OS=Drosophila melanogaster OX=7227 GN=LPCAT PE=2 SV=1
10	A0A060XS70	1.81e-40	152	373	0.174	0.244	A0A060XS70_ONCMY Lysophosphatidylcholine acyltransferase 1 OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00035526001 PE=4 SV=1
11	A0A060XK41	1.80e-39	143	180	0.135	0.394	A0A060XK41_ONCMY Phospholipid/glycerol acyltransferase domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00035523001 PE=3 SV=1
12	Q8S8S2	2.30e-32	132	539	0.204	0.199	LPCT2_ARATH Lysophospholipid acyltransferase LPEAT2 OS=Arabidopsis thaliana OX=3702 GN=LPEAT2 PE=1 SV=1
13	Q8L7R3	3.96e-26	112	398	0.162	0.214	LPCT1_ARATH Lysophospholipid acyltransferase LPEAT1 OS=Arabidopsis thaliana OX=3702 GN=LPEAT1 PE=1 SV=1
14	Q38BL2	3.02e-24	109	761	0.183	0.126	Q38BL2_TRYB2 Phospholipid/glycerol acyltransferase domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.3450 PE=4 SV=1
15	Q1ZXU8	1.09e-13	75.5	455	0.107	0.123	Q1ZXU8_CAEEL Phospholipid/glycerol acyltransferase domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=acl-5 PE=1 SV=1
16	Q21812	1.28e-13	75.5	512	0.120	0.123	Q21812_CAEEL Phospholipid/glycerol acyltransferase domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=acl-5 PE=1 SV=1
17	Q960R0	1.32e-11	68.9	458	0.120	0.138	Q960R0_DROME Glycerol-3-phosphate acyltransferase 4, isoform B OS=Drosophila melanogaster OX=7227 GN=Gpat4 PE=1 SV=1
18	Q9N5S9	1.61e-11	68.6	410	0.105	0.134	Q9N5S9_CAEEL Phospholipid/glycerol acyltransferase domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=acl-4 PE=1 SV=2
19	Q9N5S8	2.36e-11	68.6	617	0.105	0.089	Q9N5S8_CAEEL Phospholipid/glycerol acyltransferase domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=acl-4 PE=1 SV=1
20	A0A0B4LGJ9	8.68e-11	66.6	537	0.090	0.088	A0A0B4LGJ9_DROME Glycerol-3-phosphate acyltransferase 4, isoform D OS=Drosophila melanogaster OX=7227 GN=Gpat4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01553 Acyltransferase	1.8e-11	55.2	Acyltransferase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000317300

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000321038	0.953	Lysoplasmalogenase
2	9606.ENSP00000229266	0.945	Cholinephosphotransferase 1
3	9606.ENSP00000380184	0.941	Glycerol-3-phosphate acyltransferase 4
4	9606.ENSP00000389395	0.937	Glycerol-3-phosphate acyltransferase 2, mitochondrial
5	9606.ENSP00000441980	0.936	Choline/ethanolaminephosphotransferase 1
6	9606.ENSP00000302177	0.932	Lysophospholipid acyltransferase 2
7	9606.ENSP00000265276	0.931	Glycerol-3-phosphate acyltransferase 1, mitochondrial
8	9606.ENSP00000329697	0.928	Phospholipid phosphatase 2
9	9606.ENSP00000296741	0.926	Ectonucleotide pyrophosphatase/phosphodiesterase family member 6
10	9606.ENSP00000430548	0.926	Phosphatidylserine synthase 1
11	9606.ENSP00000260585	0.925	Ethanolaminephosphotransferase 1
12	9606.ENSP00000264775	0.925	Phospholipid phosphatase 1
13	9606.ENSP00000308258	0.925	Phosphatidylserine synthase 2
14	9606.ENSP00000310551	0.924	Lysocardiolipin acyltransferase 1
15	9606.ENSP00000255389	0.923	Phosphatidylethanolamine N-methyltransferase
16	9606.ENSP00000371586	0.923	Phosphatidylserine decarboxylase proenzyme, mitochondrial
17	9606.ENSP00000482571	0.921	Glycerol-3-phosphate acyltransferase 3
18	9606.ENSP00000261407	0.919	Lysophospholipid acyltransferase 5
19	9606.ENSP00000295887	0.916	Phosphatidate cytidylyltransferase 1
20	9606.ENSP00000324944	0.916	Lysophospholipid acyltransferase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003841	1.000	1-acylglycerol-3-phosphate O-acyltransferase activity
GO:0047184	0.997	1-acylglycerophosphocholine O-acyltransferase activity
GO:0016413	0.995	O-acetyltransferase activity
GO:0005515	0.686	protein binding
GO:0047144	0.509	2-acylglycerol-3-phosphate O-acyltransferase activity
GO:0047192	0.467	1-alkylglycerophosphocholine O-acetyltransferase activity
GO:0047166	0.334	1-alkenylglycerophosphoethanolamine O-acyltransferase activity
GO:0106263	0.314	1-acylglycerophosphoserine O-acyltransferase activity
GO:0106262	0.311	1-acylglycerophosphoethanolamine O-acyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006650	0.996	glycerophospholipid metabolic process
GO:1901564	0.995	organonitrogen compound metabolic process
GO:0046470	0.992	phosphatidylcholine metabolic process
GO:0008610	0.980	lipid biosynthetic process
GO:0008654	0.968	phospholipid biosynthetic process
GO:0044249	0.966	cellular biosynthetic process
GO:0046474	0.961	glycerophospholipid biosynthetic process
GO:0046471	0.891	phosphatidylglycerol metabolic process
GO:0046473	0.769	phosphatidic acid metabolic process
GO:0006654	0.550	phosphatidic acid biosynthetic process
GO:0006575	0.373	cellular modified amino acid metabolic process
GO:0036151	0.315	phosphatidylcholine acyl-chain remodeling

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005789	0.997	endoplasmic reticulum membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:19709	1.000	a 1-acyl-sn-glycero-3-phosphate + an acyl-CoA = a 1,2-diacyl-sn-glycero-3-phosphate + CoA
EC:2.3.1.51	1.000	1-acylglycerol-3-phosphate O-acyltransferase.
RHEA:12937	0.997	a 1-acyl-sn-glycero-3-phosphocholine + an acyl-CoA = a 1,2-diacyl-sn-glycero-3-phosphocholine + CoA
EC:2.3.1.23	0.997	1-acylglycerophosphocholine O-acyltransferase.
RHEA:14233	0.509	a 2-acyl-sn-glycerol 3-phosphate + an acyl-CoA = a 1,2-diacyl-sn-glycero-3-phosphate + CoA
EC:2.3.1.52	0.509	2-acylglycerol-3-phosphate O-acyltransferase.
RHEA:18461	0.467	1-O-alkyl-sn-glycero-3-phosphocholine + acetyl-CoA = a 1-O-alkyl-2-acetyl-sn-glycero-3-phosphocholine + CoA
EC:2.3.1.67	0.467	1-alkylglycerophosphocholine O-acetyltransferase.
RHEA:16245	0.334	1-O-(1Z-alkenyl)-sn-glycero-3-phosphoethanolamine + an acyl-CoA = 1-O-(1Z-alkenyl)-2-acyl-sn-glycero-3-phosphoethanolamine + CoA
EC:2.3.1.121	0.334	1-alkenylglycerophosphoethanolamine O-acyltransferase.
RHEA:33191	0.314	a 1-acyl-sn-glycero-3-phospho-L-serine + an acyl-CoA = a 1,2-diacyl-sn-glycero-3-phospho-L-serine + CoA
RHEA:32995	0.311	a 1-acyl-sn-glycero-3-phosphoethanolamine + an acyl-CoA = a 1,2-diacyl-sn-glycero-3-phosphoethanolamine + CoA

[back to server]