StarFunc result for job id Q658T7

User Input

>input (463 residues)
MTARRDPKPGAKRLVRAQTLQKQRRAPVGPRAPPPDEEDPRLKCKNCRALGHTVRSTRCP
MKCWKAALVPPTLGKKEGKENLKPWKPQVEANPGPLNKDKGEKEERPRQQDPQRKALLHI
FSGKPPEKLLPNRKGSTESSVFLRVASRPMPVHTTSKRPCVDPELADRSATEMSGRGSVL
ASLSPLRKASLRSSSSLGPKERQTGAAADIPQPAVRHQGPEPLLVVKPTHSSREGGCREV
PQAASKTHGLLQAVRPQAQDKRPAVTQPGPPAATHSLGLGSNLSFRPGAKRPAQAPIQGC
LNFPKKPRLGPFQIPESAIQGGELGALENLQPPPAATELGPSTSPQMGRRTPAQVPGVDR
QPPHSRPCLPTAQACTMSHHPAASHDGAQPLRVLFRRLENRRWSSSLLAAPSFHSPEKLG
VFLAQSPHVSEKSEGPCVRVPPNVLYEDLQVSSSSEDSDSDLQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q86YD7	0.235	0.234	9.030E-56	464	0.909	0.907	Q86YD7.pdb.gz	F90A1_HUMAN Protein FAM90A1 OS=Homo sapiens OX=9606 GN=FAM90A1 PE=1 SV=3
2	AFDB:A0A024RDC4	0.066	0.048	1.102	689	0.171	0.115	A0A024RDC4.pdb.gz
3	AFDB:Q8N1G0	0.059	0.026	1.751	1237	0.162	0.061	Q8N1G0.pdb.gz	ZN687_HUMAN Zinc finger protein 687 OS=Homo sapiens OX=9606 GN=ZNF687 PE=1 SV=1
4	AFDB:P13360	0.067	0.055	2.135	604	0.151	0.116	P13360.pdb.gz	GLAS_DROME Protein glass OS=Drosophila melanogaster OX=7227 GN=gl PE=1 SV=2
5	PDB:8escP	0.053	0.086	2.794	272	0.006	0.011	8escP.pdb.gz	Structure and flexibility of the yeast NuA4 histone acetyltransferase complex.
6	AFDB:H3BJD0	0.054	0.032	2.971	977	0.147	0.070	H3BJD0.pdb.gz	H3BJD0_MOUSE Protein phosphatase 1, regulatory subunit 9A OS=Mus musculus OX=10090 GN=Ppp1r9a PE=1 SV=1
7	PDB:3sucA	0.044	0.027	2.985	767	0.013	0.008	3sucA.pdb.gz	Crystallographic Insights Into the Autocatalytic Assembly Mechanism of a Bacteriophage Tail Spike
8	PDB:7y9tA	0.051	0.062	3.407	380	0.015	0.018	7y9tA.pdb.gz
9	AFDB:A0A0A0MSI2	0.058	0.041	3.623	830	0.156	0.087	A0A0A0MSI2.pdb.gz	A0A0A0MSI2_HUMAN Polyhomeotic homolog 2 OS=Homo sapiens OX=9606 GN=PHC2 PE=1 SV=1
10	PDB:5hutA	0.039	0.038	3.889	469	0.011	0.011	5hutA.pdb.gz	Structural and In Vivo Studies on Trehalose-6-Phosphate Synthase from Pathogenic Fungi Provide Insights into Its Catalytic Mechanism, Biological Necessity, and Potential for Novel Antifungal Drug Design.
11	PDB:6edtJ	0.060	0.221	3.889	109	0.017	0.073	6edtJ.pdb.gz	Structures of an RNA polymerase promoter melting intermediate elucidate DNA unwinding.
12	PDB:2jbhB	0.040	0.087	4.438	213	0.004	0.009	2jbhB.pdb.gz	Structural and Functional Studies of the Human Phosphoribosyltransferase Domain Containing Protein 1.
13	PDB:6ahyB	0.046	0.066	4.438	313	0.019	0.029	6ahyB.pdb.gz
14	PDB:3zqjF	0.045	0.035	4.742	607	0.011	0.008	3zqjF.pdb.gz	The Biological and Structural Characterization of Mycobacterium Tuberculosis Uvra Provides Novel Insights Into its Mechanism of Action
15	PDB:6gwjD	0.049	0.336	4.742	48	0.006	0.062	6gwjD.pdb.gz	Defects in t 6 A tRNA modification due to GON7 and YRDC mutations lead to Galloway-Mowat syndrome.
16	PDB:7mq8L8	0.039	0.098	4.742	180	0.009	0.022	7mq8L8.pdb.gz	Nucleolar maturation of the human small subunit processome.
17	AFDB:O15016	0.056	0.027	5.756	1216	0.143	0.054	O15016.pdb.gz	TRI66_HUMAN Tripartite motif-containing protein 66 OS=Homo sapiens OX=9606 GN=TRIM66 PE=1 SV=5
18	AFDB:Q9V5M3	0.080	0.047	5.756	878	0.136	0.072	Q9V5M3.pdb.gz	LOLA6_DROME Longitudinals lacking protein, isoforms N/O/W/X/Y OS=Drosophila melanogaster OX=7227 GN=lola PE=1 SV=3
19	AFDB:Q09MP3	0.062	0.031	8.012	1159	0.138	0.055	Q09MP3.pdb.gz	R51A2_HUMAN RAD51-associated protein 2 OS=Homo sapiens OX=9606 GN=RAD51AP2 PE=1 SV=1
20	AFDB:Q9LL45	0.062	0.048	9.145	633	0.138	0.101	Q9LL45.pdb.gz	TBP1_ORYSJ Telomere-binding protein 1 OS=Oryza sativa subsp. japonica OX=39947 GN=TBP1 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q86YD7	0.0	783	464	0.888	0.886	F90A1_HUMAN Protein FAM90A1 OS=Homo sapiens OX=9606 GN=FAM90A1 PE=1 SV=3
2	Q7TMB7	0.48	35.4	766	0.035	0.021	PLPR4_RAT Phospholipid phosphatase-related protein type 4 OS=Rattus norvegicus OX=10116 GN=Plppr4 PE=1 SV=1
3	P03347	4.2	32.3	512	0.030	0.027	GAG_HV1B1 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate BH10) OX=11678 GN=gag PE=1 SV=3
4	P04591	4.4	32.3	500	0.030	0.028	GAG_HV1H2 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) OX=11706 GN=gag PE=1 SV=3
5	Q77YG1	4.4	32.3	500	0.030	0.028	Q77YG1_9HIV1 Gag polyprotein OS=Human immunodeficiency virus 1 OX=11676 GN=gag PE=1 SV=1
6	Q9ERH7	5.6	32.0	1192	0.035	0.013	HIPK3_MOUSE Homeodomain-interacting protein kinase 3 OS=Mus musculus OX=10090 GN=Hipk3 PE=1 SV=3
7	P04590	6.1	32.0	522	0.086	0.077	GAG_HV2RO Gag polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate ROD) OX=11720 GN=gag PE=1 SV=3
8	Q9BRR3	8.3	31.2	403	0.037	0.042	PGAP4_HUMAN Post-GPI attachment to proteins factor 4 OS=Homo sapiens OX=9606 GN=PGAP4 PE=1 SV=1
9	O95786	9.6	31.2	925	0.037	0.018	RIGI_HUMAN Antiviral innate immune response receptor RIG-I OS=Homo sapiens OX=9606 GN=RIGI PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15288 zf-CCHC_6	2.3e-17	73.9	Zinc knuckle

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000012843

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000021987	0.733	Uncharacterized protein
2	9593.ENSGGOP00000028146	0.733	Uncharacterized protein
3	9593.ENSGGOP00000000441	0.689	ALG1, chitobiosyldiphosphodolichol beta-mannosyltransferase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.421	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.996	cellular metabolic process
GO:0071704	0.994	organic substance metabolic process
GO:0044238	0.993	primary metabolic process
GO:0006807	0.991	nitrogen compound metabolic process
GO:0050794	0.954	regulation of cellular process
GO:0043170	0.872	macromolecule metabolic process
GO:0019222	0.832	regulation of metabolic process
GO:0031323	0.817	regulation of cellular metabolic process
GO:0051171	0.811	regulation of nitrogen compound metabolic process
GO:0080090	0.810	regulation of primary metabolic process
GO:0019219	0.790	regulation of nucleobase-containing compound metabolic process
GO:0044260	0.770	cellular macromolecule metabolic process
GO:0048518	0.768	positive regulation of biological process
GO:0060255	0.761	regulation of macromolecule metabolic process
GO:0048522	0.758	positive regulation of cellular process
GO:0051252	0.686	regulation of RNA metabolic process
GO:0010556	0.656	regulation of macromolecule biosynthetic process
GO:0031326	0.656	regulation of cellular biosynthetic process
GO:0009893	0.655	positive regulation of metabolic process
GO:0010468	0.636	regulation of gene expression
GO:0031325	0.632	positive regulation of cellular metabolic process
GO:2001141	0.632	regulation of RNA biosynthetic process
GO:0006355	0.617	regulation of DNA-templated transcription
GO:0051173	0.568	positive regulation of nitrogen compound metabolic process
GO:0010604	0.541	positive regulation of macromolecule metabolic process
GO:1901564	0.530	organonitrogen compound metabolic process
GO:0019538	0.407	protein metabolic process
GO:0045935	0.400	positive regulation of nucleobase-containing compound metabolic process
GO:0043412	0.386	macromolecule modification
GO:0045893	0.364	positive regulation of DNA-templated transcription
GO:0090304	0.354	nucleic acid metabolic process
GO:0036211	0.352	protein modification process
GO:0044249	0.307	cellular biosynthetic process
GO:1901576	0.305	organic substance biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.998	nucleus
GO:0031981	0.991	nuclear lumen
GO:0005654	0.964	nucleoplasm
GO:0043232	0.962	intracellular non-membrane-bounded organelle
GO:0005694	0.939	chromosome
GO:0012505	0.335	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]