StarFunc result for job id Q659C4

User Input

>input (914 residues)
MENWPTPSELVNTGFQSVLSQGNKKPQNRKEKEEKVEKRSNSDSKENRETKLNGPGENVS
EDEAQSSNQRKRANKHKWVPLHLDVVRSESQERPGSRNSSRCQPEANKPTHNNRRNDTRS
WKRDREKRDDQDDVSSVRSEGGNIRGSFRGRGRGRGRGRGRGRGNPRLNFDYSYGYQEHG
ERTDQPFQTELNTSMMYYYDDGTGVQVYPVEEALLKEYIKRQIEYYFSVENLERDFFLRG
KMDEQGFLPISLIAGFQRVQALTTNLNLILEALKDSTEVEIVDEKMRKKIEPEKWPIPGP
PPRSVPPTDFSQLIDCPEFVPGQAFCSHTESAPNSPRIGSPLSPKKNSETSILQAMSRGL
STSLPDLDSEPWIEVKKRHQPAPVKLRESVSVPEGSLNQLCSSEEPEQEELDFLFDEEIE
QIGRKNTFTDWSDNDSDYEIDDQDLNKILIVTQTPPYVKKHPGGDRTGTHMSRAKITSEL
AKVINDGLYYYEQDLWMEEDENKHTAIKQEVENFKKLNLISKEQFENLTPELPFEPNQEV
PVAPSQSRQGGVQGVLHIPKKDLTDELAQKLFDVSEITSAAMVHSLPTAVPESPRIHPTR
TPKTPRTPRLQDPNKTPRFYPVVKEPKAIDVKSPRKRKTRHSTNPPLECHVGWVMDSRDR
GPGTSSVSTSNASPSEGAPLAGSYGCTPHSFPKFQHPSHELLKENGFTQQVYHKYRRRCL
SERKRLGIGQSQEMNTLFRFWSFFLRDHFNKKMYEEFRQLAWEDAKENYRYGLECLFRFY
SYGLEKKFRREIFQDFQEETKKDYESGQLYGLEKFWAYLKYSQSKTQSIDPKLQEYLCSF
KRLEDFRVDPPISDEFGRKRHSSTSGEESNRHRLPPNSSTKPPNAAKPTSTSELQVPINS
PRRNISPESSDNSH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q659C4	1.000	1.000	0.000	914	1.000	1.000	Q659C4.pdb.gz	LAR1B_HUMAN La-related protein 1B OS=Homo sapiens OX=9606 GN=LARP1B PE=1 SV=2
2	AFDB:Q5JRA6	0.052	0.033	4.615E-3	1907	0.149	0.071	Q5JRA6.pdb.gz	TGO1_HUMAN Transport and Golgi organization protein 1 homolog OS=Homo sapiens OX=9606 GN=MIA3 PE=1 SV=1
3	AFDB:Q99607	0.071	0.093	1.924E-2	663	0.117	0.161	Q99607.pdb.gz	ELF4_HUMAN ETS-related transcription factor Elf-4 OS=Homo sapiens OX=9606 GN=ELF4 PE=1 SV=1
4	AFDB:F4IZM8	0.089	0.064	2.749E-2	1347	0.123	0.083	F4IZM8.pdb.gz	HUAL3_ARATH Protein HUA2-LIKE 3 OS=Arabidopsis thaliana OX=3702 GN=HULK3 PE=2 SV=1
5	AFDB:Q9I7T7	0.110	0.069	4.577E-2	1531	0.129	0.077	Q9I7T7.pdb.gz	LAR4_DROME La-related protein Larp4B OS=Drosophila melanogaster OX=7227 GN=Larp4B PE=1 SV=2
6	AFDB:A0A0R4IZ84	0.067	0.045	8.020E-2	1544	0.132	0.078	A0A0R4IZ84.pdb.gz	EST1A_DANRE Telomerase-binding protein EST1A OS=Danio rerio OX=7955 GN=smg6 PE=2 SV=1
7	AFDB:F1NNE8	0.060	0.077	8.020E-2	660	0.112	0.155	F1NNE8.pdb.gz	F1NNE8_CHICK Forkhead box O3 OS=Gallus gallus OX=9031 GN=FOXO3 PE=2 SV=4
8	AFDB:F4HTH8	0.055	0.045	8.881E-2	1181	0.120	0.093	F4HTH8.pdb.gz	KTN82_ARATH Katanin p80 WD40 repeat-containing subunit B1 homolog KTN80.2 OS=Arabidopsis thaliana OX=3702 GN=KTN80.2 PE=1 SV=1
9	AFDB:Q76E23	0.078	0.049	1.035E-1	1727	0.163	0.086	Q76E23.pdb.gz	IF4G_ARATH Eukaryotic translation initiation factor 4G OS=Arabidopsis thaliana OX=3702 GN=EIF4G PE=1 SV=2
10	AFDB:Q9C5E7	0.103	0.108	1.089E-1	861	0.117	0.124	Q9C5E7.pdb.gz	PUM6_ARATH Pumilio homolog 6, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=APUM6 PE=1 SV=1
11	PDB:4qvgC	0.058	0.132	1.381	349	0.014	0.037	4qvgC.pdb.gz
12	PDB:2xhkB	0.047	0.147	2.420	217	0.022	0.092	2xhkB.pdb.gz	Structural Basis for the Regulation of Ntca-Dependent Transcription by Proteins Pipx and Pii.
13	PDB:6lqsRP	0.118	0.055	3.639	2180	0.028	0.012	6lqsRP.pdb.gz	Cryo-EM structure of 90 S small ribosomal subunit precursors in transition states.
14	PDB:7ff0A	0.054	0.185	3.639	206	0.011	0.049	7ff0A.pdb.gz	Inhibitory mechanism of gold analogues against Pseudomonas global virulence factor regulator Vfr
15	PDB:1x19A	0.061	0.138	3.829	350	0.015	0.040	1x19A.pdb.gz
16	PDB:6hivBI	0.089	0.218	3.829	319	0.019	0.053	6hivBI.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
17	PDB:1ft9A	0.062	0.216	4.030	210	0.015	0.067	1ft9A.pdb.gz	Structure of the CO sensing transcription activator CooA.
18	PDB:3zc0B	0.059	0.189	4.030	191	0.020	0.094	3zc0B.pdb.gz	Structural Basis for Duplex RNA Recognition and Cleavage by Archaeoglobus Fulgidus C3Po.
19	PDB:5l4kN	0.074	0.076	4.241	876	0.022	0.023	5l4kN.pdb.gz
20	PDB:7pe9I	0.070	0.171	4.241	317	0.019	0.054	7pe9I.pdb.gz	Regulation of human mTOR complexes by DEPTOR.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q659C4	0.0	1890	914	1.000	1.000	LAR1B_HUMAN La-related protein 1B OS=Homo sapiens OX=9606 GN=LARP1B PE=1 SV=2
2	Q6PKG0	0.0	951	1096	0.594	0.495	LARP1_HUMAN La-related protein 1 OS=Homo sapiens OX=9606 GN=LARP1 PE=1 SV=2
3	D5MCN2	8.60e-95	325	1150	0.253	0.201	LARP1_CAEEL La-related protein 1 OS=Caenorhabditis elegans OX=6239 GN=larp-1 PE=4 SV=2
4	Q9VAW5	2.66e-92	323	1673	0.170	0.093	LARP_DROME La-related protein 1 OS=Drosophila melanogaster OX=7227 GN=larp PE=1 SV=5
5	Q940X9	7.62e-53	201	826	0.112	0.123	LRP1A_ARATH La-related protein 1A OS=Arabidopsis thaliana OX=3702 GN=LARP1A PE=1 SV=1
6	F4K704	4.10e-52	199	833	0.109	0.120	F4K704_ARATH LA RNA-binding protein OS=Arabidopsis thaliana OX=3702 GN=LARP1A PE=1 SV=1
7	Q8RWR2	1.64e-17	88.6	452	0.046	0.093	LRP1B_ARATH La-related protein 1B OS=Arabidopsis thaliana OX=3702 GN=LARP1B PE=1 SV=2
8	Q94K80	9.47e-17	86.7	523	0.080	0.140	LRP1C_ARATH La-related protein 1C OS=Arabidopsis thaliana OX=3702 GN=LARP1C PE=1 SV=1
9	Q9P6K0	6.96e-15	80.5	475	0.039	0.076	YLA3_SCHPO Uncharacterized HTH La-type RNA-binding protein C1527.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC1527.03 PE=1 SV=1
10	Q71RC2	1.49e-11	70.9	724	0.053	0.066	LARP4_HUMAN La-related protein 4 OS=Homo sapiens OX=9606 GN=LARP4 PE=1 SV=3
11	Q9I7T7	1.52e-11	71.2	1531	0.034	0.020	LAR4_DROME La-related protein Larp4B OS=Drosophila melanogaster OX=7227 GN=Larp4B PE=1 SV=2
12	P25567	3.88e-11	68.6	434	0.039	0.083	SRO9_YEAST RNA-binding protein SRO9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SRO9 PE=1 SV=2
13	Q6P4E2	4.95e-11	67.8	374	0.054	0.131	Q6P4E2_HUMAN LARP4 protein OS=Homo sapiens OX=9606 GN=LARP4 PE=1 SV=1
14	Q96J85	7.63e-11	67.4	375	0.042	0.101	Q96J85_HUMAN C-Mpl binding protein OS=Homo sapiens OX=9606 GN=LARP4 PE=1 SV=1
15	P40796	6.65e-10	64.3	390	0.040	0.095	LA_DROME La protein homolog OS=Drosophila melanogaster OX=7227 GN=La PE=1 SV=2
16	Q54TG6	7.12e-09	60.8	354	0.035	0.090	Q54TG6_DICDI Lupus La protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0281763 PE=1 SV=1
17	Q9NIH4	2.01e-08	59.3	335	0.027	0.075	Q9NIH4_9TRYP RNA binding protein La-like protein OS=Trypanosoma brucei OX=5691 PE=1 SV=1
18	Q38C07	2.09e-08	59.3	335	0.027	0.075	Q38C07_TRYB2 La protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.5360 PE=4 SV=1
19	Q9N9G6	2.09e-08	59.3	335	0.027	0.075	Q9N9G6_9TRYP La protein OS=Trypanosoma brucei OX=5691 GN=La PE=2 SV=1
20	P05455	1.18e-07	57.4	408	0.042	0.093	LA_HUMAN Lupus La protein OS=Homo sapiens OX=9606 GN=SSB PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05383 La	2.8e-18	76.9	La domain
2	PF17228 SGP	19	17.5	Sulphur globule protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000321997

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000438863	0.766	Proton-activated chloride channel that mediates import of chloride ion in response to extracellular acidic pH (PubMed:31023925, PubMed:31318332). Involved in acidosis-induced cell death by mediating chloride influx and subsequent cell swelling (PubMed:31023925, PubMed:31318332)
2	9606.ENSP00000355955	0.712	Neudesin
3	9606.ENSP00000226319	0.687	Protein Jade-1
4	9606.ENSP00000313007	0.673	Polyadenylate-binding protein 1
5	9606.ENSP00000348959	0.651	Mannosyl-oligosaccharide 1,2-alpha-mannosidase IB
6	9606.ENSP00000385000	0.646	Kinesin-like protein KIF2A
7	9606.ENSP00000429301	0.642	Membrane-associated progesterone receptor component 2
8	9606.ENSP00000368540	0.635	Ubiquitin associated protein 2
9	9606.ENSP00000283928	0.632	Juxtaposed with another zinc finger protein 1
10	9606.ENSP00000336721	0.626	La-related protein 1
11	9606.ENSP00000425561	0.626	Eukaryotic translation initiation factor 4E
12	9606.ENSP00000358363	0.623	Myomegalin
13	9606.ENSP00000376097	0.618	Unconventional prefoldin RPB5 interactor 1
14	9606.ENSP00000380718	0.616	Chromodomain Y-like protein
15	9606.ENSP00000452454	0.610	Transcription initiation factor IIA subunit 1
16	9606.ENSP00000451812	0.608	Protein lin-52 homolog
17	9606.ENSP00000416255	0.589	Eukaryotic translation initiation factor 4 gamma 1
18	9606.ENSP00000420294	0.587	Polyhomeotic-like protein 3
19	9606.ENSP00000383274	0.573	Eukaryotic translation initiation factor 4 gamma 3
20	9606.ENSP00000281589	0.572	Polyadenylate-binding protein 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.997	regulation of biological process
GO:0051246	0.989	regulation of protein metabolic process
GO:0009987	0.986	cellular process
GO:2000112	0.985	regulation of cellular macromolecule biosynthetic process
GO:0048518	0.982	positive regulation of biological process
GO:0009893	0.970	positive regulation of metabolic process
GO:0034248	0.964	regulation of amide metabolic process
GO:0010468	0.962	regulation of gene expression
GO:0071704	0.936	organic substance metabolic process
GO:0050896	0.922	response to stimulus
GO:0044238	0.894	primary metabolic process
GO:0006807	0.892	nitrogen compound metabolic process
GO:0010608	0.890	post-transcriptional regulation of gene expression
GO:0044237	0.874	cellular metabolic process
GO:0048522	0.865	positive regulation of cellular process
GO:0043170	0.855	macromolecule metabolic process
GO:0048523	0.835	negative regulation of cellular process
GO:0034641	0.833	cellular nitrogen compound metabolic process
GO:0019219	0.826	regulation of nucleobase-containing compound metabolic process
GO:0009892	0.814	negative regulation of metabolic process
GO:0006417	0.800	regulation of translation
GO:0010467	0.725	gene expression
GO:0010604	0.710	positive regulation of macromolecule metabolic process
GO:0010605	0.701	negative regulation of macromolecule metabolic process
GO:0051252	0.670	regulation of RNA metabolic process
GO:0051172	0.658	negative regulation of nitrogen compound metabolic process
GO:0031324	0.645	negative regulation of cellular metabolic process
GO:0031325	0.637	positive regulation of cellular metabolic process
GO:0051173	0.520	positive regulation of nitrogen compound metabolic process
GO:0044260	0.513	cellular macromolecule metabolic process
GO:0031329	0.452	regulation of cellular catabolic process
GO:0019538	0.444	protein metabolic process
GO:0031327	0.436	negative regulation of cellular biosynthetic process
GO:0010558	0.435	negative regulation of macromolecule biosynthetic process
GO:0051248	0.431	negative regulation of protein metabolic process
GO:0010557	0.428	positive regulation of macromolecule biosynthetic process
GO:0031328	0.428	positive regulation of cellular biosynthetic process
GO:0010629	0.421	negative regulation of gene expression
GO:0045727	0.418	positive regulation of translation
GO:2000113	0.393	negative regulation of cellular macromolecule biosynthetic process
GO:0034249	0.386	negative regulation of amide metabolic process
GO:0006950	0.380	response to stress
GO:0017148	0.376	negative regulation of translation
GO:0044249	0.370	cellular biosynthetic process
GO:0043487	0.367	regulation of RNA stability
GO:0044271	0.361	cellular nitrogen compound biosynthetic process
GO:0031330	0.360	negative regulation of cellular catabolic process
GO:0009059	0.358	macromolecule biosynthetic process
GO:0051716	0.353	cellular response to stimulus
GO:0006412	0.351	translation
GO:0043488	0.333	regulation of mRNA stability

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005737	0.953	cytoplasm
GO:0005829	0.933	cytosol
GO:0032991	0.901	protein-containing complex
GO:0043232	0.792	intracellular non-membrane-bounded organelle
GO:1990904	0.367	ribonucleoprotein complex
GO:0036464	0.346	cytoplasmic ribonucleoprotein granule
GO:0070013	0.334	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]