StarFunc result for job id Q66GS9

User Input

>input (1140 residues)
MTTAVERKYINIRKRLDQLGYRQTLTVECLPLVEKLFSDLVHTTESLRQSKLSAVKAEKE
SANFDFVLEPYKLENARLSRENNELYLELMKLREHSDQHVKELKTSLKKCARETADLKFL
NNQYAHKLKLLEKESKAKNERIQQLQEKNLHAVVQTPGGKKRSIAFRRQRMQIDEPVPPS
EVSSYPVPQPDDPYIADLLQVADNRIQELQQEVHQLQEKLAMMESGVRDYSKQIELRERE
IERLSVALDGGRSPDVLSLESRNKTNEKLIAHLNIQVDFLQQANKDLEKRIRELMETKET
VTSEVVNLSNKNEKLCQELTEIDQLAQQLERHKEEVLETADKELGEAKKEIKRKLSEMQD
LEETMAKLQLELNLCQKEKERLSDELLVKSDLETVVHQLEQEKQRLSKKVESFAVTERQL
TLEVERMRLEHGIKRRDRSPSRLDTFLKGIEEERDYYKKELERLQHIIQRRSCSTSYSAR
EKSSIFRTPEKGDYNSEIHQITRERDELQRMLERFEKYMEDIQSNVKLLTAERDKLSVLY
NEAQEELSALRKESTQTTAPHNIVSLMEKEKELALSDLRRIMAEKEALREKLEHIEEVSL
FGKSELEKTIEHLTCVNHQLESEKYELKSKVLIMKETIESLENKLKVQAQKFSHVAGDSS
HQKTEVNSLRIVNEQLQRSVDDYQHRLSIKRGELESAQAQIKILEEKIDELNLKMTSQDE
EAHVMKKTIGVIDKEKDFLQETVDEKTEKIANLQENLANKEKAVAQMKIMISECESSVNQ
LKETLVNRDREINSLRRQLDAAHKELDEVGRSREIAFKENRRLQDDLATMARENQEISLE
LEAAVQEKEEMKSRVHKYITEVSRWESLMAAKEKENQDLLDRFQMLHNRAEDWEVKAHQA
EGESSSVRLELLSIDTERRHLRERVELLEKEIQEHINAHHAYESQISSMAKAMSRLEEEL
RHQEDEKATVLNDLSSLRELCIKLDSGKDIMTQQLNSKNLEFERVVVELENVKSESDLLK
KQLSNERHTVKNLESLLATNRDKEFHSHLTSHEKDTEIQLLKEKLTLSESKLTSQSRENT
MLRAKVAQLQTDYDALKRQISTERYERERAIQEMRRHGLATPPLSSTLRSPSHSPEHRNV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q66GS9	1.000	1.000	0.000	1140	1.000	1.000	Q66GS9.pdb.gz	CP135_HUMAN Centrosomal protein of 135 kDa OS=Homo sapiens OX=9606 GN=CEP135 PE=1 SV=2
2	AFDB:Q9Z220	0.120	0.178	5.468E-21	712	0.225	0.360	Q9Z220.pdb.gz	TSG10_RAT Testis-specific gene 10 protein OS=Rattus norvegicus OX=10116 GN=Tsga10 PE=1 SV=2
3	AFDB:M9MSL4	0.115	0.123	4.964E-15	1065	0.209	0.223	M9MSL4.pdb.gz	M9MSL4_DROME Centrosomal protein 135kDa, isoform B OS=Drosophila melanogaster OX=7227 GN=Cep135 PE=4 SV=1
4	AFDB:Q9VXU1	0.141	0.134	9.424E-6	1208	0.170	0.161	Q9VXU1.pdb.gz	Q9VXU1_DROME Golgi microtubule-associated protein, isoform B OS=Drosophila melanogaster OX=7227 GN=Gmap PE=1 SV=2
5	AFDB:Q5EE04	0.080	0.054	7.910E-4	1997	0.181	0.103	Q5EE04.pdb.gz	TPR_XENLA Nucleoprotein TPR (Fragment) OS=Xenopus laevis OX=8355 GN=tpr PE=1 SV=1
6	AFDB:Q9BQS8	0.106	0.083	1.053E-3	1478	0.174	0.134	Q9BQS8.pdb.gz	FYCO1_HUMAN FYVE and coiled-coil domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FYCO1 PE=1 SV=3
7	AFDB:Q96Q89	0.096	0.064	1.864E-3	1820	0.150	0.094	Q96Q89.pdb.gz	KI20B_HUMAN Kinesin-like protein KIF20B OS=Homo sapiens OX=9606 GN=KIF20B PE=1 SV=3
8	AFDB:A0A0B4J1F9	0.086	0.064	3.074E-3	1599	0.167	0.119	A0A0B4J1F9.pdb.gz	A0A0B4J1F9_MOUSE Trichohyalin OS=Mus musculus OX=10090 GN=Tchh PE=1 SV=1
9	AFDB:Q61595	0.110	0.097	7.783E-3	1327	0.167	0.143	Q61595.pdb.gz	KTN1_MOUSE Kinectin OS=Mus musculus OX=10090 GN=Ktn1 PE=1 SV=1
10	AFDB:Q5T9S5	0.111	0.090	8.979E-3	1454	0.166	0.130	Q5T9S5.pdb.gz	CCD18_HUMAN Coiled-coil domain-containing protein 18 OS=Homo sapiens OX=9606 GN=CCDC18 PE=1 SV=1
11	PDB:6o3sA	0.027	0.439	2.344	47	0.005	0.128	6o3sA.pdb.gz
12	PDB:5lj5O	0.034	0.114	2.905	283	0.027	0.110	5lj5O.pdb.gz	Cryo-EM structure of the spliceosome immediately after branching.
13	PDB:5c0wL	0.036	0.321	4.790	113	0.008	0.080	5c0wL.pdb.gz	RNA degradation paths in a 12-subunit nuclear exosome complex.
14	PDB:7sqcO1	0.089	0.139	4.790	673	0.041	0.070	7sqcO1.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
15	PDB:7wtxt	0.023	0.182	4.790	132	0.020	0.174	7wtxt.pdb.gz	The nucleoplasmic phase of pre-40S formation prior to nuclear export.
16	PDB:6j6gc	0.046	0.096	5.526	436	0.043	0.112	6j6gc.pdb.gz	Structures of the Catalytically Activated Yeast Spliceosome Reveal the Mechanism of Branching.
17	PDB:2looA	0.026	0.227	6.847	99	0.007	0.081	2looA.pdb.gz
18	PDB:7o42A	0.024	0.028	7.354	937	0.002	0.002	7o42A.pdb.gz
19	PDB:3jc5A	0.026	0.123	7.899	208	0.009	0.048	3jc5A.pdb.gz
20	PDB:6cp6Y	0.032	0.129	8.484	188	0.006	0.037	6cp6Y.pdb.gz	High-resolution cryo-EM analysis of the yeast ATP synthase in a lipid membrane.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q66GS9	0.0	2281	1140	1.000	1.000	CP135_HUMAN Centrosomal protein of 135 kDa OS=Homo sapiens OX=9606 GN=CEP135 PE=1 SV=2
2	Q6NY15	1.74e-145	455	697	0.232	0.379	TSG10_MOUSE Testis-specific gene 10 protein OS=Mus musculus OX=10090 GN=Tsga10 PE=1 SV=1
3	Q9BZW7	2.34e-145	455	698	0.232	0.380	TSG10_HUMAN Testis-specific gene 10 protein OS=Homo sapiens OX=9606 GN=TSGA10 PE=1 SV=1
4	Q9Z220	2.25e-136	432	712	0.232	0.371	TSG10_RAT Testis-specific gene 10 protein OS=Rattus norvegicus OX=10116 GN=Tsga10 PE=1 SV=2
5	M9MSL4	2.76e-17	90.1	1065	0.083	0.089	M9MSL4_DROME Centrosomal protein 135kDa, isoform B OS=Drosophila melanogaster OX=7227 GN=Cep135 PE=4 SV=1
6	Q960T6	2.85e-17	90.1	1059	0.082	0.089	Q960T6_DROME Centrosomal protein 135kDa, isoform A OS=Drosophila melanogaster OX=7227 GN=Cep135 PE=1 SV=1
7	M9PCK8	3.35e-17	89.7	960	0.082	0.098	M9PCK8_DROME Centrosomal protein 135kDa, isoform C OS=Drosophila melanogaster OX=7227 GN=Cep135 PE=4 SV=1
8	Q1D823	0.068	40.0	1395	0.139	0.114	AGLZ_MYXXD Adventurous-gliding motility protein Z OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=aglZ PE=1 SV=1
9	Q9CW79	0.12	38.9	758	0.059	0.088	GOGA1_MOUSE Golgin subfamily A member 1 OS=Mus musculus OX=10090 GN=Golga1 PE=1 SV=2
10	Q9Y7Y1	0.27	37.7	547	0.060	0.124	SGM1_SCHPO Protein sgm1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sgm1 PE=3 SV=1
11	Q9UKX3	0.32	37.7	1938	0.038	0.022	MYH13_HUMAN Myosin-13 OS=Homo sapiens OX=9606 GN=MYH13 PE=2 SV=2
12	M9PFP4	0.39	37.4	1701	0.053	0.035	M9PFP4_DROME Pericentrin-like protein, isoform O OS=Drosophila melanogaster OX=7227 GN=Plp PE=1 SV=1
13	Q92805	0.45	37.0	767	0.059	0.087	GOGA1_HUMAN Golgin subfamily A member 1 OS=Homo sapiens OX=9606 GN=GOLGA1 PE=1 SV=3
14	M9PFA3	0.49	37.0	1757	0.053	0.034	M9PFA3_DROME Pericentrin-like protein, isoform H OS=Drosophila melanogaster OX=7227 GN=Plp PE=1 SV=1
15	M9PFP0	0.55	37.0	2666	0.053	0.023	M9PFP0_DROME Pericentrin-like protein, isoform J OS=Drosophila melanogaster OX=7227 GN=Plp PE=1 SV=1
16	Q6UBD8	0.58	37.0	2726	0.053	0.022	Q6UBD8_DROME 309 kDa centrosomal protein OS=Drosophila melanogaster OX=7227 GN=Plp PE=2 SV=1
17	M9PFA8	0.59	37.0	2650	0.053	0.023	M9PFA8_DROME Pericentrin-like protein, isoform N OS=Drosophila melanogaster OX=7227 GN=Plp PE=1 SV=1
18	M9PCK2	0.60	37.0	2594	0.053	0.023	M9PCK2_DROME Pericentrin-like protein, isoform M OS=Drosophila melanogaster OX=7227 GN=Plp PE=1 SV=1
19	M9NFV3	0.61	37.0	2767	0.053	0.022	M9NFV3_DROME Pericentrin-like protein, isoform D OS=Drosophila melanogaster OX=7227 GN=Plp PE=1 SV=1
20	M9PFJ2	0.65	37.0	2831	0.053	0.021	M9PFJ2_DROME Pericentrin-like protein, isoform K OS=Drosophila melanogaster OX=7227 GN=Plp PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17675 APG6_N	22	16.9	Apg6 coiled-coil region
2	PF08614 ATG16	4e+02	12.6	Autophagy protein 16 (ATG16)
3	PF04108 ATG17_like	6.4	17.7	Autophagy protein ATG17-like domain
4	PF19220 Crescentin	13	16.3	Crescentin protein
5	PF14053 DUF4248	8.1e+02	11.5	Domain of unknown function (DUF4248)
6	PF13851 GAS	13	16.6	Growth-arrest specific micro-tubule binding
7	PF14662 KASH_CCD	32	15.8	Coiled-coil region of CCDC155 or KASH

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000257287

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000287482	0.994	Spindle assembly abnormal protein 6 homolog
2	9606.ENSP00000371308	0.994	Centromere protein J
3	9606.ENSP00000370337	0.983	Centrosomal protein of 152 kDa
4	9606.ENSP00000270861	0.957	Serine/threonine-protein kinase PLK4
5	9606.ENSP00000360944	0.941	SCL-interrupting locus protein
6	9606.ENSP00000370803	0.932	Centriolar coiled-coil protein of 110 kDa
7	9606.ENSP00000343818	0.917	CDK5 regulatory subunit-associated protein 2
8	9606.ENSP00000316681	0.911	Centrosomal protein of 295 kDa
9	9606.ENSP00000336524	0.909	Centrosomal protein of 63 kDa
10	9606.ENSP00000384792	0.896	WD repeat-containing protein 62
11	9606.ENSP00000270708	0.873	WD repeat-containing protein WRAP73
12	9606.ENSP00000356379	0.869	Abnormal spindle-like microcephaly-associated protein
13	9606.ENSP00000287380	0.853	TBC1 domain family member 31
14	9606.ENSP00000352572	0.817	Pericentrin
15	9606.ENSP00000251413	0.805	Tubulin gamma-1 chain
16	9606.ENSP00000342924	0.803	Microcephalin
17	9606.ENSP00000303058	0.787	Centrosomal protein of 120 kDa
18	9606.ENSP00000427550	0.786	Centrosomal protein of 192 kDa
19	9606.ENSP00000448012	0.781	Centrosomal protein of 290 kDa
20	9606.ENSP00000344314	0.776	Oral-facial-digital syndrome 1 protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.990	regulation of cellular process
GO:0007098	0.989	centrosome cycle
GO:0140694	0.984	non-membrane-bounded organelle assembly
GO:0044089	0.975	positive regulation of cellular component biogenesis
GO:0060341	0.974	regulation of cellular localization
GO:0010638	0.973	positive regulation of organelle organization
GO:0051298	0.957	centrosome duplication
GO:1902117	0.956	positive regulation of organelle assembly
GO:0032880	0.952	regulation of protein localization
GO:0098534	0.951	centriole assembly
GO:1902017	0.929	regulation of cilium assembly
GO:0007099	0.927	centriole replication
GO:1903829	0.925	positive regulation of protein localization
GO:0031346	0.851	positive regulation of cell projection organization
GO:1904951	0.508	positive regulation of establishment of protein localization
GO:0120034	0.421	positive regulation of plasma membrane bounded cell projection assembly

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.998	cytosol
GO:0005814	0.998	centriole
GO:0005813	0.998	centrosome
GO:0043227	0.939	membrane-bounded organelle
GO:0005929	0.468	cilium
GO:0043233	0.425	organelle lumen
GO:0031981	0.424	nuclear lumen
GO:0032991	0.387	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]