StarFunc result for job id Q66K14

User Input

>input (1250 residues)
MWLSPEEVLVANALWVTERANPFFVLQRRRGHGRGGGLTGLLVGTLDVVLDSSARVAPYR
ILHQTQDSQVYWTVACGSSRKEITKHWEWLENNLLQTLSIFDSEEDITTFVKGKIHGIIA
EENKNLQPQGDEDPGKFKEAELKMRKQFGMPEGEKLVNYYSCSYWKGRVPRQGWLYLTVN
HLCFYSFLLGKEVSLVVQWVDITRLEKNATLLFPESIRVDTRDQELFFSMFLNIGETFKL
MEQLANLAMRQLLDSEGFLEDKALPRPIRPHRNISALKRDLDARAKNECYRATFRLPRDE
RLDGHTSCTLWTPFNKLHIPGQMFISNNYICFASKEEDACHLIIPLREVTIVEKADSSSV
LPSPLSISTKSKMTFLFANLKDRDFLVQRISDFLQKTPSKQPGSIGSRKASVVDPSTESS
PAPQEGSEQPASPASPLSSRQSFCAQEAPTASQGLLKLFQKNSPMEDLGAKGAKEKMKEE
SWHIHFFEYGRGVCMYRTAKTRALVLKGIPESLRGELWLLFSGAWNEMVTHPGYYAELVE
KSTGKYSLATEEIERDLHRSMPEHPAFQNELGIAALRRVLTAYAFRNPTIGYCQAMNIVT
SVLLLYGSEEEAFWLLVALCERMLPDYYNTRVVGALVDQGIFEELTRDFLPQLSEKMQDL
GVISSISLSWFLTLFLSVMPFESAVVIVDCFFYEGIKVILQVALAVLDANMEQLLGCSDE
GEAMTMLGRYLDNVVNKQSVSPPIPHLRALLSSSDDPPAEVDIFELLKVSYEKFSSLRAE
DIEQMRFKQRLKVIQSLEDTAKRSVVRAIPVDIGFSIEELEDLYMVFKAKHLASQYWGCS
RTMAGRRDPSLPYLEQYRIDASQFRELFASLTPWACGSHTPLLAGRMFRLLDENKDSLIN
FKEFVTGMSGMYHGDLTEKLKVLYKLHLPPALSPEEAESALEAAHYFTEDSSSEASPLAS
DLDLFLPWEAQEALPQEEQEGSGSEERGEEKGTSSPDYRHYLRMWAKEKEAQKETIKDLP
KMNQEQFIELCKTLYNMFSEDPMEQDLYHAIATVASLLLRIGEVGKKFSARTGRKPRDCA
TEEDEPPAPELHQDAARELQPPAAGDPQAKAGGDTHLGKAPQESQVVVEGGSGEGQGSPS
QLLSDDETKDDMSMSSYSVVSTGSLQCEDLADDTVLVGGEACSPTARIGGTVDTDWCISF
EQILASILTESVLVNFFEKRVDIGLKIKDQKKVERQFSTASDHEQPGVSG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q66K14	1.000	1.000	0.000	1250	1.000	1.000	Q66K14.pdb.gz	TBC9B_HUMAN TBC1 domain family member 9B OS=Homo sapiens OX=9606 GN=TBC1D9B PE=1 SV=3
2	AFDB:Q6ZT07	0.782	0.773	0.000	1266	0.635	0.627	Q6ZT07.pdb.gz	TBCD9_HUMAN TBC1 domain family member 9 OS=Homo sapiens OX=9606 GN=TBC1D9 PE=2 SV=2
3	AFDB:B0R0W9	0.651	0.730	1.510E-90	1108	0.441	0.497	B0R0W9.pdb.gz	TBC8B_DANRE TBC1 domain family member 8B OS=Danio rerio OX=7955 GN=tbc1d8b PE=1 SV=1
4	AFDB:O43048	0.416	0.608	1.429E-32	834	0.158	0.237	O43048.pdb.gz	YH51_SCHPO TBC domain-containing protein C215.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC215.01 PE=3 SV=4
5	AFDB:P53258	0.410	0.533	5.594E-32	950	0.156	0.205	P53258.pdb.gz	GYP2_YEAST GTPase-activating protein GYP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MDR1 PE=1 SV=1
6	AFDB:O94711	0.414	0.691	3.085E-28	720	0.136	0.236	O94711.pdb.gz	GYP2_SCHPO GTPase-activating protein gyp2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gyp2 PE=3 SV=1
7	AFDB:Q9VGL8	0.219	0.684	5.188E-13	363	0.074	0.256	Q9VGL8.pdb.gz	TBWKD_DROME TBC1 domain family member whacked OS=Drosophila melanogaster OX=7227 GN=wkd PE=1 SV=1
8	AFDB:Q9BXI6	0.209	0.488	7.301E-12	508	0.108	0.266	Q9BXI6.pdb.gz	TB10A_HUMAN TBC1 domain family member 10A OS=Homo sapiens OX=9606 GN=TBC1D10A PE=1 SV=1
9	AFDB:Q54IL5	0.102	0.081	1.788E-11	1697	0.061	0.045	Q54IL5.pdb.gz	UGT52_DICDI UDP-sugar-dependent glycosyltransferase 52 OS=Dictyostelium discoideum OX=44689 GN=ugt52 PE=2 SV=1
10	AFDB:P35125	0.208	0.186	1.576E-8	1406	0.055	0.049	P35125.pdb.gz	UBP6_HUMAN Ubiquitin carboxyl-terminal hydrolase 6 OS=Homo sapiens OX=9606 GN=USP6 PE=1 SV=2
11	PDB:6xtbE	0.073	0.360	9.883E-8	235	0.030	0.157	6xtbE.pdb.gz
12	PDB:5yqrA	0.088	0.381	2.132E-5	268	0.027	0.127	5yqrA.pdb.gz
13	PDB:7nkyQ	0.073	0.187	2.323E-4	404	0.031	0.097	7nkyQ.pdb.gz	Structural basis of nucleosome transcription mediated by Chd1 and FACT.
14	PDB:3ljuX	0.090	0.225	3.410E-4	373	0.028	0.094	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
15	PDB:1lw3A	0.081	0.189	4.596E-4	513	0.030	0.074	1lw3A.pdb.gz
16	PDB:7c3mA	0.070	0.135	1.126E-3	577	0.024	0.052	7c3mA.pdb.gz
17	PDB:6upkH	0.070	0.191	6.198E-3	411	0.027	0.083	6upkH.pdb.gz	FACT caught in the act of manipulating the nucleosome.
18	PDB:4mk0A	0.074	0.138	8.719E-3	631	0.013	0.025	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
19	PDB:7r04B	0.068	0.050	1.725E-2	2229	0.071	0.040	7r04B.pdb.gz	Structural basis of activation of the tumor suppressor protein neurofibromin.
20	PDB:3pvuA	0.067	0.134	1.879E-2	609	0.014	0.028	3pvuA.pdb.gz	Molecular Mechanism of Selectivity among G Protein-Coupled Receptor Kinase 2 Inhibitors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A1L3A9	0.0	2540	1232	0.986	1.000	A1L3A9_HUMAN TBC1 domain family, member 9B (With GRAM domain) OS=Homo sapiens OX=9606 GN=TBC1D9B PE=1 SV=1
2	B0R0W9	0.0	1012	1108	0.450	0.507	TBC8B_DANRE TBC1 domain family member 8B OS=Danio rerio OX=7955 GN=tbc1d8b PE=1 SV=1
3	O95759	0.0	1093	1140	0.462	0.507	TBCD8_HUMAN TBC1 domain family member 8 OS=Homo sapiens OX=9606 GN=TBC1D8 PE=1 SV=3
4	Q0IIM8	0.0	1067	1120	0.443	0.495	TBC8B_HUMAN TBC1 domain family member 8B OS=Homo sapiens OX=9606 GN=TBC1D8B PE=1 SV=2
5	Q66K14	0.0	2588	1250	1.000	1.000	TBC9B_HUMAN TBC1 domain family member 9B OS=Homo sapiens OX=9606 GN=TBC1D9B PE=1 SV=3
6	Q6ZT07	0.0	1482	1266	0.635	0.627	TBCD9_HUMAN TBC1 domain family member 9 OS=Homo sapiens OX=9606 GN=TBC1D9 PE=2 SV=2
7	P53258	1.29e-69	255	950	0.140	0.184	GYP2_YEAST GTPase-activating protein GYP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MDR1 PE=1 SV=1
8	O43048	4.53e-63	233	834	0.110	0.165	YH51_SCHPO TBC domain-containing protein C215.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC215.01 PE=3 SV=4
9	O94711	2.08e-52	199	720	0.117	0.203	GYP2_SCHPO GTPase-activating protein gyp2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gyp2 PE=3 SV=1
10	Q8VCZ6	4.45e-42	168	750	0.078	0.129	SGSM3_MOUSE Small G protein signaling modulator 3 OS=Mus musculus OX=10090 GN=Sgsm3 PE=1 SV=1
11	Q96HU1	4.49e-42	168	749	0.071	0.119	SGSM3_HUMAN Small G protein signaling modulator 3 OS=Homo sapiens OX=9606 GN=SGSM3 PE=1 SV=1
12	Q75JG4	1.19e-38	159	986	0.106	0.135	Q75JG4_DICDI RabGAP/TBC domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=cnrF PE=4 SV=1
13	P87234	8.14e-37	150	635	0.064	0.126	GYP3_SCHPO GTPase-activating protein gyp3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gyp3 PE=1 SV=1
14	Q23419	1.60e-36	152	908	0.065	0.089	Q23419_CAEEL PH domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=tbc-2 PE=1 SV=2
15	Q8IV04	8.51e-35	141	446	0.065	0.182	TB10C_HUMAN Carabin OS=Homo sapiens OX=9606 GN=TBC1D10C PE=1 SV=1
16	Q12317	1.08e-34	142	492	0.069	0.175	MSB4_YEAST GTPase-activating protein MSB4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MSB4 PE=1 SV=1
17	Q9VGL8	2.31e-34	138	363	0.061	0.209	TBWKD_DROME TBC1 domain family member whacked OS=Drosophila melanogaster OX=7227 GN=wkd PE=1 SV=1
18	Q8C9V1	2.47e-34	140	444	0.070	0.196	TB10C_MOUSE Carabin OS=Mus musculus OX=10090 GN=Tbc1d10c PE=1 SV=1
19	A0A384L1W6	3.35e-32	131	353	0.084	0.297	A0A384L1W6_ARATH (thale cress) hypothetical protein OS=Arabidopsis thaliana OX=3702 GN=At3g02460 PE=1 SV=1
20	Q9BXI6	8.59e-32	133	508	0.070	0.171	TB10A_HUMAN TBC1 domain family member 10A OS=Homo sapiens OX=9606 GN=TBC1D10A PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00036 EF-hand_1	0.33	21.7	EF hand
2	PF02893 GRAM	3.7e-42	154.2	GRAM domain
3	PF00566 RabGAP-TBC	6.2e-44	161.8	Rab-GTPase-TBC domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000349291

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000330221	0.706	SPRY domain-containing SOCS box protein 1
2	9606.ENSP00000336831	0.697	Plastin-1
3	9606.ENSP00000346139	0.672	TBC1 domain family member 20
4	9606.ENSP00000388713	0.672	LanC-like protein 1
5	9606.ENSP00000341071	0.670	Rho guanine nucleotide exchange factor 3
6	9606.ENSP00000300935	0.662	Ras-related protein Rab-8A
7	9606.ENSP00000313050	0.657	Protein NipSnap homolog 2
8	9606.ENSP00000316845	0.649	Rho guanine nucleotide exchange factor 4
9	9606.ENSP00000261890	0.627	Ras-related protein Rab-11A
10	9606.ENSP00000411197	0.627	TBC1 domain family member 9
11	9606.ENSP00000037243	0.622	Gamma-aminobutyric acid receptor-associated protein-like 2
12	9606.ENSP00000266458	0.611	Gamma-aminobutyric acid receptor-associated protein-like 1
13	9606.ENSP00000355651	0.593	Ras-related protein Rab-4A
14	9606.ENSP00000300504	0.564	TBC1 domain family member 21
15	9606.ENSP00000402935	0.553	TBC1 domain family member 5
16	9606.ENSP00000362590	0.552	TBC1 domain family member 22B
17	9606.ENSP00000317614	0.546	Zinc finger protein 518B
18	9606.ENSP00000448182	0.531	TBC1 domain family member 15
19	9606.ENSP00000306866	0.513	Gamma-aminobutyric acid receptor-associated protein
20	9606.ENSP00000365962	0.512	TBC1 domain family member 25

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.996	protein binding
GO:0008047	0.325	enzyme activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.899	biological regulation
GO:0009987	0.853	cellular process
GO:0050789	0.750	regulation of biological process
GO:0050794	0.653	regulation of cellular process
GO:0051179	0.495	localization
GO:0051234	0.461	establishment of localization
GO:0006810	0.450	transport
GO:0032501	0.336	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	1.000	cellular anatomical entity
GO:0005575	1.000	cellular_component
GO:0005737	0.992	cytoplasm
GO:0016020	0.991	membrane
GO:0005829	0.956	cytosol
GO:0043226	0.856	organelle
GO:0043227	0.851	membrane-bounded organelle
GO:0043229	0.752	intracellular organelle
GO:0043231	0.730	intracellular membrane-bounded organelle
GO:0071944	0.498	cell periphery
GO:0005886	0.481	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]