StarFunc result for job id Q66K74

User Input

>input (1059 residues)
MAAVAGSGAAAAPSSLLLVVGSEFGSPGLLTYVLEELERGIRSWDVDPGVCNLDEQLKVF
VSRHSATFSSIVKGQRSLHHRGDNLETLVLLNPSDKSLYDELRNLLLDPASHKLLVLAGP
CLEETGELLLQTGGFSPHHFLQVLKDREIRDILATTPPPVQPPILTITCPTFGDWAQLAP
AVPGLQGALRLQLRLNPPAQLPNSEGLCEFLEYVAESLEPPSPFELLEPPTSGGFLRLGR
PCCYIFPGGLGDAAFFAVNGFTVLVNGGSNPKSSFWKLVRHLDRVDAVLVTHPGADSLPG
LNSLLRRKLAERSEVAAGGGSWDDRLRRLISPNLGVVFFNACEAASRLARGEDEAELALS
LLAQLGITPLPLSRGPVPAKPTVLFEKMGVGRLDMYVLHPPSAGAERTLASVCALLVWHP
AGPGEKVVRVLFPGCTPPACLLDGLVRLQHLRFLREPVVTPQDLEGPGRAESKESVGSRD
SSKREGLLATHPRPGQERPGVARKEPARAEAPRKTEKEAKTPRELKKDPKPSVSRTQPRE
VRRAASSVPNLKKTNAQAAPKPRKAPSTSHSGFPPVANGPRSPPSLRCGEASPPSAACGS
PASQLVATPSLELGPIPAGEEKALELPLAASSIPRPRTPSPESHRSPAEGSERLSLSPLR
GGEAGPDASPTVTTPTVTTPSLPAEVGSPHSTEVDESLSVSFEQVLPPSAPTSEAGLSLP
LRGPRARRSASPHDVDLCLVSPCEFEHRKAVPMAPAPASPGSSNDSSARSQERAGGLGAE
ETPPTSVSESLPTLSDSDPVPLAPGAADSDEDTEGFGVPRHDPLPDPLKVPPPLPDPSSI
CMVDPEMLPPKTARQTENVSRTRKPLARPNSRAAAPKATPVAAAKTKGLAGGDRASRPLS
ARSEPSEKGGRAPLSRKSSTPKTATRGPSGSASSRPGVSATPPKSPVYLDLAYLPSGSSA
HLVDEEFFQRVRALCYVISGQDQRKEEGMRAVLDALLASKQHWDRDLQVTLIPTFDSVAM
HTWYAETHARHQALGITVLGSNSMVSMQDDAFPACKVEF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A8K940	0.597	0.597	0.000	1059	0.999	0.999	A8K940.pdb.gz	A8K940_HUMAN cDNA FLJ77630, highly similar to Homo sapiens BPY2 interacting protein 1, mRNA OS=Homo sapiens OX=9606 PE=1 SV=1
2	AFDB:Q8C052	0.566	0.614	0.000	973	0.643	0.700	Q8C052.pdb.gz	MAP1S_MOUSE Microtubule-associated protein 1S OS=Mus musculus OX=10090 GN=Map1s PE=1 SV=2
3	AFDB:B2ZZ14	0.513	0.275	1.670E-58	2033	0.427	0.222	B2ZZ14.pdb.gz	B2ZZ14_DANRE Hypothetical microtubule-associated protein 1b OS=Danio rerio OX=7955 GN=map1b PE=2 SV=1
4	AFDB:P46821	0.414	0.185	1.325E-55	2468	0.297	0.128	P46821.pdb.gz	MAP1B_HUMAN Microtubule-associated protein 1B OS=Homo sapiens OX=9606 GN=MAP1B PE=1 SV=2
5	PDB:5evdA	0.100	0.311	4.799E-4	267	0.037	0.146	5evdA.pdb.gz	Cross-class metallo-beta-lactamase inhibition by bisthiazolidines reveals multiple binding modes.
6	PDB:5lztjj	0.088	0.165	5.679E-4	428	0.032	0.079	5lztjj.pdb.gz	Decoding Mammalian Ribosome-mRNA States by Translational GTPase Complexes.
7	PDB:1z6xA	0.083	0.288	1.053E-3	175	0.024	0.143	1z6xA.pdb.gz	Structure Of Human ADP-Ribosylation Factor 4
8	PDB:2ycbB	0.102	0.158	1.559E-3	635	0.042	0.069	2ycbB.pdb.gz	Structure and Activity of a Novel Archaeal Beta-Casp Protein with N-Terminal Kh Domains.
9	PDB:3aq4A	0.079	0.321	1.845E-3	170	0.024	0.147	3aq4A.pdb.gz	Molecular insights into plant cell proliferation disturbance by Agrobacterium protein 6b
10	PDB:3lrpA	0.092	0.374	2.583E-3	181	0.020	0.116	3lrpA.pdb.gz	Structure of Plasmodium falciparum ADP-ribosylation factor 1.
11	PDB:6ji2A	0.081	0.161	2.732E-3	432	0.032	0.079	6ji2A.pdb.gz	Switch of the interactions between the ribosomal stalk and EF1A in the GTP- and GDP-bound conformations.
12	PDB:2k5uA	0.089	0.339	2.890E-3	180	0.028	0.167	2k5uA.pdb.gz	Structure and Membrane Interaction of Myristoylated ARF1
13	PDB:6jkaC	0.097	0.329	2.890E-3	228	0.027	0.127	6jkaC.pdb.gz	Identification of the Inhibitory Compounds for Metallo-beta-lactamases and Structural Analysis of the Binding Modes.
14	PDB:1ob2A	0.090	0.179	3.056E-3	393	0.026	0.071	1ob2A.pdb.gz	Kirromycin Defines a Specific Domain Arrangement of Elongation Factor EF-TU
15	AFDB:Q9P2F8	0.062	0.049	2.283E-1	1722	0.141	0.087	Q9P2F8.pdb.gz	SI1L2_HUMAN Signal-induced proliferation-associated 1-like protein 2 OS=Homo sapiens OX=9606 GN=SIPA1L2 PE=1 SV=2
16	AFDB:O60292	0.059	0.045	2.554E-1	1781	0.135	0.080	O60292.pdb.gz	SI1L3_HUMAN Signal-induced proliferation-associated 1-like protein 3 OS=Homo sapiens OX=9606 GN=SIPA1L3 PE=1 SV=3
17	AFDB:Q9LTJ8	0.046	0.056	1.300	746	0.074	0.105	Q9LTJ8.pdb.gz	MBD13_ARATH Methyl-CpG-binding domain-containing protein 13 OS=Arabidopsis thaliana OX=3702 GN=MBD13 PE=2 SV=1
18	AFDB:O43166	0.063	0.041	1.375	1804	0.145	0.085	O43166.pdb.gz	SI1L1_HUMAN Signal-induced proliferation-associated 1-like protein 1 OS=Homo sapiens OX=9606 GN=SIPA1L1 PE=1 SV=4
19	AFDB:A0A024R885	0.054	0.059	2.036	898	0.114	0.135	A0A024R885.pdb.gz
20	AFDB:Q86AT9	0.057	0.038	2.153	1736	0.073	0.044	Q86AT9.pdb.gz	DHKI_DICDI Hybrid signal transduction histidine kinase I OS=Dictyostelium discoideum OX=44689 GN=dhkI-1 PE=3 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A8K940	0.0	2093	1059	0.999	0.999	A8K940_HUMAN cDNA FLJ77630, highly similar to Homo sapiens BPY2 interacting protein 1, mRNA OS=Homo sapiens OX=9606 PE=1 SV=1
2	P0C5W1	0.0	1042	972	0.644	0.702	MAP1S_RAT Microtubule-associated protein 1S OS=Rattus norvegicus OX=10116 GN=Map1s PE=1 SV=1
3	Q66K74	0.0	2095	1059	1.000	1.000	MAP1S_HUMAN Microtubule-associated protein 1S OS=Homo sapiens OX=9606 GN=MAP1S PE=1 SV=2
4	Q8C052	0.0	1069	973	0.642	0.699	MAP1S_MOUSE Microtubule-associated protein 1S OS=Mus musculus OX=10090 GN=Map1s PE=1 SV=2
5	P15205	3.47e-144	481	2461	0.245	0.105	MAP1B_RAT Microtubule-associated protein 1B OS=Rattus norvegicus OX=10116 GN=Map1b PE=1 SV=3
6	P46821	6.39e-143	477	2468	0.246	0.106	MAP1B_HUMAN Microtubule-associated protein 1B OS=Homo sapiens OX=9606 GN=MAP1B PE=1 SV=2
7	P14873	7.90e-143	476	2464	0.243	0.104	MAP1B_MOUSE Microtubule-associated protein 1B OS=Mus musculus OX=10090 GN=Map1b PE=1 SV=2
8	B2ZZ14	1.25e-140	468	2033	0.241	0.125	B2ZZ14_DANRE Hypothetical microtubule-associated protein 1b OS=Danio rerio OX=7955 GN=map1b PE=2 SV=1
9	Q9QYR6	3.15e-84	303	2776	0.174	0.066	MAP1A_MOUSE Microtubule-associated protein 1A OS=Mus musculus OX=10090 GN=Map1a PE=1 SV=2
10	P78559	5.52e-84	302	2803	0.173	0.065	MAP1A_HUMAN Microtubule-associated protein 1A OS=Homo sapiens OX=9606 GN=MAP1A PE=1 SV=6
11	P34926	1.06e-83	301	2774	0.173	0.066	MAP1A_RAT Microtubule-associated protein 1A OS=Rattus norvegicus OX=10116 GN=Map1a PE=1 SV=1
12	Q9W596	4.60e-63	238	5495	0.145	0.028	FUTSC_DROME Microtubule-associated protein futsch OS=Drosophila melanogaster OX=7227 GN=futsch PE=1 SV=4
13	P91859	6.5	33.1	878	0.078	0.095	MAP11_CAEEL Microtubule-associated protein homolog maph-1.1 OS=Caenorhabditis elegans OX=6239 GN=maph-1.1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12706 Lactamase_B_2	2.3e+02	12.7	Beta-lactamase superfamily domain
2	PF16661 Lactamase_B_6	60	14.5	Metallo-beta-lactamase superfamily domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000325313

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000260665	0.976	Leucine-rich PPR motif-containing protein, mitochondrial
2	9606.ENSP00000349547	0.973	Ras association domain-containing protein 1
3	9606.ENSP00000330341	0.912	Suppressor of cytokine signaling 3
4	9606.ENSP00000475750	0.829	Heme-binding protein 2
5	9606.ENSP00000341219	0.820	Cat eye syndrome critical region protein 2
6	9606.ENSP00000462099	0.776	Ras association domain-containing protein 5
7	9606.ENSP00000337393	0.744	Protein UXT
8	9606.ENSP00000361892	0.735	Serine/threonine-protein kinase 4
9	9606.ENSP00000429744	0.728	Serine/threonine-protein kinase 3
10	9606.ENSP00000359506	0.705	Synaptic functional regulator FMR1
11	9606.ENSP00000232165	0.681	Ubiquitin-protein ligase E3A
12	9606.ENSP00000400852	0.672	Zinc finger protein 736
13	9606.ENSP00000297423	0.661	DNA repair-scaffolding protein
14	9606.ENSP00000476795	0.654	Gigaxonin
15	9606.ENSP00000363667	0.649	Tyrosine-protein phosphatase non-receptor type 3
16	9606.ENSP00000331258	0.647	Protein O-mannose kinase
17	9606.ENSP00000393583	0.631	Centrosomal protein of 131 kDa
18	9606.ENSP00000368965	0.627	Heparan-alpha-glucosaminide N-acetyltransferase
19	9606.ENSP00000303423	0.620	Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha
20	9606.ENSP00000264606	0.617	Histone deacetylase 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008092	1.000	cytoskeletal protein binding
GO:0015631	0.987	tubulin binding
GO:0008017	0.984	microtubule binding
GO:0044877	0.537	protein-containing complex binding
GO:0003779	0.520	actin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0007017	0.974	microtubule-based process
GO:0000226	0.958	microtubule cytoskeleton organization
GO:0048856	0.948	anatomical structure development
GO:0007399	0.906	nervous system development
GO:0008152	0.895	metabolic process
GO:0044237	0.752	cellular metabolic process
GO:0051179	0.672	localization
GO:0051641	0.544	cellular localization
GO:0051234	0.540	establishment of localization
GO:0051649	0.484	establishment of localization in cell
GO:0006810	0.459	transport
GO:0046907	0.421	intracellular transport
GO:0051656	0.414	establishment of organelle localization
GO:0065007	0.407	biological regulation
GO:0050789	0.403	regulation of biological process
GO:0007018	0.394	microtubule-based movement
GO:0050794	0.388	regulation of cellular process
GO:0048869	0.352	cellular developmental process
GO:0030154	0.337	cell differentiation
GO:0001578	0.337	microtubule bundle formation
GO:0022008	0.334	neurogenesis
GO:0048468	0.332	cell development
GO:0044248	0.319	cellular catabolic process
GO:0010970	0.317	transport along microtubule
GO:0120039	0.311	plasma membrane bounded cell projection morphogenesis
GO:0048812	0.304	neuron projection morphogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0015630	1.000	microtubule cytoskeleton
GO:0005829	0.999	cytosol
GO:0042995	0.998	cell projection
GO:0005654	0.997	nucleoplasm
GO:0099080	0.675	supramolecular complex
GO:0030054	0.674	cell junction
GO:0005813	0.655	centrosome
GO:0016020	0.585	membrane
GO:0120025	0.576	plasma membrane bounded cell projection
GO:0005730	0.534	nucleolus
GO:0099512	0.504	supramolecular fiber
GO:0005819	0.487	spindle
GO:0099513	0.464	polymeric cytoskeletal fiber
GO:0045202	0.457	synapse
GO:0048471	0.432	perinuclear region of cytoplasm
GO:0044297	0.425	cell body
GO:0032991	0.424	protein-containing complex
GO:0043005	0.424	neuron projection
GO:0005874	0.421	microtubule
GO:0043025	0.397	neuronal cell body
GO:0072686	0.335	mitotic spindle
GO:0012505	0.318	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]