StarFunc result for job id Q66K89

User Input

>input (784 residues)
MEGAMAVRVTAAHTAEAQAEAGREAGEGAVAAVAAALAPSGFLGLPAPFSEEDEDDVHRC
GRCQAEFTALEDFVQHKIQKACQRAPPEALPATPATTALLGQEVVPAAPGPEEPITVAHI
VVEAASLAADISHASDLVGGGHIKEVIVAAEAELGDGEMAEAPGSPRQQGLGLAGEGEQA
QVKLLVNKDGRYVCALCHKTFKTGSILKAHMVTHSSRKDHECKLCGASFRTKGSLIRHHR
RHTDERPYKCSKCGKSFRESGALTRHLKSLTPCTEKIRFSVSKDVVVSKEDARAGSGAGA
AGLGTATSSVTGEPIETSPVIHLVTDAKGTVIHEVHVQMQELSLGMKALAPEPPVSQELP
CSSEGSRENLLHQAMQNSGIVLERAAGEEGALEPAPAAGSSPQPLAVAAPQLPVLEVQPL
ETQVASEASAVPRTHPCPQCSETFPTAATLEAHKRGHTGPRPFACAQCGKAFPKAYLLKK
HQEVHVRERRFRCGDCGKLYKTIAHVRGHRRVHSDERPYPCPKCGKRYKTKNAQQVHFRT
HLEEKPHVCQFCSRGFREKGSLVRHVRHHTGEKPFKCYKCGRGFAEHGTLNRHLRTKGGC
LLEVEELLVSEDSPAAATTVLTEDPHTVLVEFSSVVADTQEYIIEATADDAETSEATEII
EGTQTEVDSHIMKVVQQIVHQASAGHQIIVQNVTMDEETALGPEAAAADTITIATPESLT
EQVAMTLASAISEGTVLAARAGTSGTEQATVTMVSSEDIEILEHAGELVIASPEGQLEVQ
TVIV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q66K89	1.000	1.000	0.000	784	1.000	1.000	Q66K89.pdb.gz	E4F1_HUMAN Transcription factor E4F1 OS=Homo sapiens OX=9606 GN=E4F1 PE=1 SV=2
2	AFDB:Q8CCE9	0.423	0.423	5.853E-101	783	0.883	0.884	Q8CCE9.pdb.gz	E4F1_MOUSE Transcription factor E4F1 OS=Mus musculus OX=10090 GN=E4f1 PE=1 SV=2
3	AFDB:H3BSL4	0.168	0.212	7.046E-70	607	0.774	1.000	H3BSL4.pdb.gz	H3BSL4_HUMAN E4F transcription factor 1 OS=Homo sapiens OX=9606 GN=E4F1 PE=1 SV=1
4	AFDB:M9PG92	0.171	0.169	2.304E-22	794	0.175	0.173	M9PG92.pdb.gz	M9PG92_DROME Jim, isoform G OS=Drosophila melanogaster OX=7227 GN=jim PE=4 SV=1
5	AFDB:Q8TF47	0.186	0.224	2.450E-22	636	0.159	0.197	Q8TF47.pdb.gz	ZFP90_HUMAN Zinc finger protein 90 homolog OS=Homo sapiens OX=9606 GN=ZFP90 PE=1 SV=2
6	AFDB:P21506	0.254	0.335	2.771E-22	573	0.157	0.215	P21506.pdb.gz	ZNF10_HUMAN Zinc finger protein 10 OS=Homo sapiens OX=9606 GN=ZNF10 PE=1 SV=3
7	AFDB:O96395	0.193	0.254	1.547E-21	583	0.152	0.204	O96395.pdb.gz	O96395_DROME LD05664p OS=Drosophila melanogaster OX=7227 GN=Meics PE=2 SV=2
8	AFDB:Q9UL36	0.124	0.060	1.806E-20	1845	0.194	0.082	Q9UL36.pdb.gz	ZN236_HUMAN Zinc finger protein 236 OS=Homo sapiens OX=9606 GN=ZNF236 PE=1 SV=2
9	AFDB:Q9BYN7	0.225	0.209	1.982E-19	854	0.176	0.162	Q9BYN7.pdb.gz	ZN341_HUMAN Zinc finger protein 341 OS=Homo sapiens OX=9606 GN=ZNF341 PE=1 SV=2
10	AFDB:A0A0B4KEI8	0.197	0.129	2.535E-19	1270	0.173	0.107	A0A0B4KEI8.pdb.gz	A0A0B4KEI8_DROME Uncharacterized protein, isoform C OS=Drosophila melanogaster OX=7227 GN=p190 PE=4 SV=1
11	PDB:3w5kB	0.072	0.318	8.650E-4	110	0.043	0.309	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:1npdB	0.057	0.134	8.415E-1	288	0.011	0.031	1npdB.pdb.gz	The 2.3-A crystal structure of the shikimate 5-dehydrogenase orthologue YdiB from Escherichia coli suggests a novel catalytic environment for an NAD-dependent dehydrogenase
13	PDB:7btbm	0.052	0.072	1.144	469	0.056	0.094	7btbm.pdb.gz	Structural insights into assembly of the ribosomal nascent polypeptide exit tunnel.
14	PDB:7pmkQ	0.035	0.036	1.216	766	0.028	0.029	7pmkQ.pdb.gz	A conserved mechanism for regulating replisome disassembly in eukaryotes.
15	PDB:7dvqM	0.033	0.109	1.463	191	0.032	0.131	7dvqM.pdb.gz	Structure of the activated human minor spliceosome.
16	PDB:6ff47	0.037	0.233	1.759	93	0.015	0.129	6ff47.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
17	PDB:6n8jm	0.042	0.065	1.759	378	0.027	0.056	6n8jm.pdb.gz	Tightly-orchestrated rearrangements govern catalytic center assembly of the ribosome.
18	PDB:1p9pA	0.047	0.133	2.115	235	0.018	0.060	1p9pA.pdb.gz	Insights into Catalysis by a Knotted TrmD tRNA Methyltransferase.
19	PDB:7rycD	0.035	0.094	2.249	263	0.013	0.038	7rycD.pdb.gz	The oxytocin signaling complex reveals a molecular switch for cation dependence.
20	PDB:5gm6I	0.038	0.264	2.704	102	0.013	0.098	5gm6I.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	H3BSL4	0.0	754	607	0.476	0.614	H3BSL4_HUMAN E4F transcription factor 1 OS=Homo sapiens OX=9606 GN=E4F1 PE=1 SV=1
2	H3BUJ7	0.0	1281	654	0.801	0.960	H3BUJ7_HUMAN E4F transcription factor 1 OS=Homo sapiens OX=9606 GN=E4F1 PE=1 SV=1
3	Q66K89	0.0	1581	784	1.000	1.000	E4F1_HUMAN Transcription factor E4F1 OS=Homo sapiens OX=9606 GN=E4F1 PE=1 SV=2
4	Q8CCE9	0.0	1337	783	0.881	0.883	E4F1_MOUSE Transcription factor E4F1 OS=Mus musculus OX=10090 GN=E4f1 PE=1 SV=2
5	Q9NYW8	2.59e-49	187	714	0.162	0.178	RBAK_HUMAN RB-associated KRAB zinc finger protein OS=Homo sapiens OX=9606 GN=RBAK PE=1 SV=1
6	Q8N184	1.57e-48	184	647	0.165	0.199	ZN567_HUMAN Zinc finger protein 567 OS=Homo sapiens OX=9606 GN=ZNF567 PE=1 SV=3
7	Q9UJW7	2.02e-46	180	825	0.153	0.145	ZN229_HUMAN Zinc finger protein 229 OS=Homo sapiens OX=9606 GN=ZNF229 PE=1 SV=4
8	Q5MCW4	4.37e-46	177	686	0.158	0.181	ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens OX=9606 GN=ZNF569 PE=1 SV=1
9	Q8TAQ5	2.74e-45	175	688	0.162	0.185	ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens OX=9606 GN=ZNF420 PE=1 SV=1
10	Q8BLA2	1.39e-44	171	578	0.158	0.215	Q8BLA2_MOUSE C2H2-type domain-containing protein OS=Mus musculus OX=10090 GN=Zfp420 PE=2 SV=1
11	Q9Y2P7	1.85e-44	172	627	0.159	0.199	ZN256_HUMAN Zinc finger protein 256 OS=Homo sapiens OX=9606 GN=ZNF256 PE=1 SV=2
12	Q7TMN8	3.33e-44	170	578	0.158	0.215	Q7TMN8_MOUSE Zfp420 protein OS=Mus musculus OX=10090 GN=Zfp420 PE=1 SV=1
13	P15620	6.53e-44	169	580	0.148	0.200	ZN271_MOUSE Zinc finger protein 271 OS=Mus musculus OX=10090 GN=Znf271 PE=2 SV=1
14	P51523	1.13e-43	171	738	0.166	0.176	ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens OX=9606 GN=ZNF84 PE=1 SV=2
15	P17021	7.75e-43	167	662	0.147	0.174	ZNF17_HUMAN Zinc finger protein 17 OS=Homo sapiens OX=9606 GN=ZNF17 PE=1 SV=3
16	Q9UII5	1.21e-42	168	783	0.151	0.151	ZN107_HUMAN Zinc finger protein 107 OS=Homo sapiens OX=9606 GN=ZNF107 PE=1 SV=1
17	Q05481	3.09e-42	168	1191	0.147	0.097	ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens OX=9606 GN=ZNF91 PE=2 SV=2
18	Q4VA13	4.16e-42	165	630	0.157	0.195	Q4VA13_MOUSE OTTMUSG00000011070 protein OS=Mus musculus OX=10090 GN=Zfp980 PE=2 SV=1
19	P17027	5.03e-42	165	643	0.147	0.179	ZNF23_HUMAN Zinc finger protein 23 OS=Homo sapiens OX=9606 GN=ZNF23 PE=1 SV=3
20	E9PZP6	5.56e-42	163	546	0.161	0.231	E9PZP6_MOUSE Zinc finger protein 97 OS=Mus musculus OX=10090 GN=Zfp97 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12773 DZR	9.1e+02	11.3	Double zinc ribbon
2	PF00096 zf-C2H2	1.2e-31	118.5	Zinc finger, C2H2 type
3	PF16622 zf-C2H2_11	0.096	23.8	zinc-finger C2H2-type
4	PF12756 zf-C2H2_2	63	15.3	C2H2 type zinc-finger (2 copies)
5	PF13894 zf-C2H2_4	7.4e-26	99.6	C2H2-type zinc finger
6	PF13912 zf-C2H2_6	1.7e-06	39.1	C2H2-type zinc finger
7	PF15909 zf-C2H2_8	18	17.1	C2H2-type zinc ribbon
8	PF12171 zf-C2H2_jaz	1.3e-12	58.8	Zinc-finger double-stranded RNA-binding
9	PF13913 zf-C2HC_2	0.18	23.0	zinc-finger of a C2HC-type
10	PF13465 zf-H2C2_2	9.6e-31	116.1	Zinc-finger double domain
11	PF12874 zf-met	1.7e+02	14.0	Zinc-finger of C2H2 type
12	PF18439 zf_UBZ	0.15	23.0	Ubiquitin-Binding Zinc Finger
13	PF17032 zinc_ribbon_15	2.1e+02	14.1	zinc-ribbon family
14	PF09723 Zn-ribbon_8	71	15.0	Zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000301727

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000269305	0.998	Cellular tumor antigen p53
2	9606.ENSP00000418915	0.864	Cyclin-dependent kinase inhibitor 2A
3	9606.ENSP00000362649	0.762	Histone deacetylase 1
4	9606.ENSP00000349547	0.709	Ras association domain-containing protein 1
5	9606.ENSP00000473391	0.704	annotation not available
6	9606.ENSP00000295050	0.691	SprT-like domain-containing protein Spartan
7	9606.ENSP00000307292	0.677	Caveolae-associated protein 3
8	9606.ENSP00000263274	0.675	DNA ligase 1
9	9606.ENSP00000363017	0.667	Replication protein A 32 kDa subunit
10	9606.ENSP00000417864	0.640	Acidic leucine-rich nuclear phosphoprotein 32 family member A
11	9606.ENSP00000386665	0.619	Four and a half LIM domains protein 2
12	9606.ENSP00000325017	0.592	Condensin complex subunit 1
13	9606.ENSP00000375053	0.540	Transmembrane protein 203
14	9606.ENSP00000446093	0.504	Gamma-tubulin complex component 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003677	1.000	DNA binding
GO:0000976	0.989	transcription cis-regulatory region binding
GO:0140110	0.982	transcription regulator activity
GO:0000977	0.982	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0140297	0.956	DNA-binding transcription factor binding
GO:0000987	0.923	cis-regulatory region sequence-specific DNA binding
GO:0061629	0.919	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0001228	0.913	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0000978	0.907	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001227	0.849	DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0035497	0.497	cAMP response element binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0080090	0.987	regulation of primary metabolic process
GO:0051171	0.986	regulation of nitrogen compound metabolic process
GO:0060255	0.982	regulation of macromolecule metabolic process
GO:0031323	0.962	regulation of cellular metabolic process
GO:0048518	0.930	positive regulation of biological process
GO:0010468	0.909	regulation of gene expression
GO:0019219	0.902	regulation of nucleobase-containing compound metabolic process
GO:0048522	0.875	positive regulation of cellular process
GO:2001141	0.875	regulation of RNA biosynthetic process
GO:0006355	0.874	regulation of DNA-templated transcription
GO:0048519	0.870	negative regulation of biological process
GO:0048523	0.859	negative regulation of cellular process
GO:0010604	0.839	positive regulation of macromolecule metabolic process
GO:0051172	0.834	negative regulation of nitrogen compound metabolic process
GO:0009987	0.832	cellular process
GO:0031324	0.827	negative regulation of cellular metabolic process
GO:0045893	0.825	positive regulation of DNA-templated transcription
GO:0010605	0.824	negative regulation of macromolecule metabolic process
GO:0010564	0.780	regulation of cell cycle process
GO:0006357	0.731	regulation of transcription by RNA polymerase II
GO:0045934	0.678	negative regulation of nucleobase-containing compound metabolic process
GO:0051253	0.655	negative regulation of RNA metabolic process
GO:0045944	0.650	positive regulation of transcription by RNA polymerase II
GO:1902679	0.646	negative regulation of RNA biosynthetic process
GO:1903507	0.627	negative regulation of nucleic acid-templated transcription
GO:0045892	0.620	negative regulation of DNA-templated transcription
GO:0008152	0.495	metabolic process
GO:0071704	0.427	organic substance metabolic process
GO:0044238	0.425	primary metabolic process
GO:0006807	0.399	nitrogen compound metabolic process
GO:0044237	0.381	cellular metabolic process
GO:0043170	0.329	macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005737	0.574	cytoplasm
GO:0005829	0.407	cytosol
GO:0043232	0.384	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]