StarFunc result for job id Q66LE6

User Input

>input (453 residues)
MAGAGGGGCPAGGNDFQWCFSQVKGAIDEDVAEADIISTVEFNYSGDLLATGDKGGRVVI
FQREQENKSRPHSRGEYNVYSTFQSHEPEFDYLKSLEIEEKINKIRWLPQQNAAHFLLST
NDKTIKLWKISERDKRAEGYNLKDEDGRLRDPFRITALRVPILKPMDLMVEASPRRIFAN
AHTYHINSISVNSDHETYLSADDLRINLWHLEITDRSFNIVDIKPANMEELTEVITAAEF
HPHQCNVFVYSSSKGTIRLCDMRSSALCDRHSKFFEEPEDPSSRSFFSEIISSISDVKFS
HSGRYMMTRDYLSVKVWDLNMESRPVETHQVHEYLRSKLCSLYENDCIFDKFECCWNGSD
SAIMTGSYNNFFRMFDRDTRRDVTLEASRESSKPRASLKPRKVCTGGKRRKDEISVDSLD
FNKKILHTAWHPVDNVIAVAATNNLYIFQDKIN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P56932	0.976	0.976	2.923E-87	453	0.967	0.967	P56932.pdb.gz	2ABD_RAT Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B delta isoform OS=Rattus norvegicus OX=10116 GN=Ppp2r2d PE=2 SV=1
2	AFDB:A2BG80	0.970	0.981	1.267E-82	448	0.872	0.882	A2BG80.pdb.gz	A2BG80_DANRE Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B OS=Danio rerio OX=7955 GN=MDS026 PE=1 SV=3
3	AFDB:P36872	0.957	0.870	6.422E-78	499	0.773	0.701	P36872.pdb.gz	2ABA_DROME Protein phosphatase PP2A 55 kDa regulatory subunit OS=Drosophila melanogaster OX=7227 GN=tws PE=2 SV=1
4	AFDB:X1WDS4	0.959	0.974	1.478E-77	446	0.770	0.783	X1WDS4.pdb.gz	X1WDS4_DANRE Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B OS=Danio rerio OX=7955 GN=ppp2r2aa PE=1 SV=1
5	AFDB:P36877	0.922	0.942	1.127E-76	443	0.821	0.840	P36877.pdb.gz	2ABB_RAT Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B beta isoform OS=Rattus norvegicus OX=10116 GN=Ppp2r2b PE=1 SV=2
6	AFDB:Q9Y2T4	0.922	0.934	3.543E-76	447	0.795	0.805	Q9Y2T4.pdb.gz	2ABG_HUMAN Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B gamma isoform OS=Homo sapiens OX=9606 GN=PPP2R2C PE=1 SV=4
7	PDB:3dw8E	0.904	0.972	3.556E-71	421	0.830	0.893	3dw8E.pdb.gz	Structure of a protein phosphatase 2A holoenzyme: insights into B55-mediated Tau dephosphorylation.
8	AFDB:G5EDR3	0.912	0.836	4.624E-67	495	0.658	0.602	G5EDR3.pdb.gz	2AB1_CAEEL Serine/threonine-protein phosphatase 2A regulatory subunit sur-6 OS=Caenorhabditis elegans OX=6239 GN=sur-6 PE=1 SV=1
9	AFDB:C8VMY3	0.878	0.844	4.807E-61	472	0.574	0.551	C8VMY3.pdb.gz	C8VMY3_EMENI Protein phosphatase PP2A regulatory subunit B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_01545 PE=3 SV=1
10	AFDB:Q54Q99	0.861	0.809	4.754E-60	483	0.528	0.495	Q54Q99.pdb.gz	PH2AB_DICDI Serine/threonine-protein phosphatase 2A regulatory subunit phr2AB OS=Dictyostelium discoideum OX=44689 GN=phr2aB PE=3 SV=1
11	AFDB:Q12702	0.843	0.826	7.597E-60	463	0.563	0.551	Q12702.pdb.gz	2ABA_SCHPO Protein phosphatase PP2A regulatory subunit B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pab1 PE=1 SV=2
12	PDB:2h9lA	0.574	0.795	2.637E-15	321	0.155	0.218	2h9lA.pdb.gz
13	PDB:5yzgs	0.518	0.621	4.874E-14	374	0.130	0.158	5yzgs.pdb.gz	Structure of a human catalytic step I spliceosome
14	PDB:5nnzA	0.490	0.643	5.698E-14	335	0.141	0.191	5nnzA.pdb.gz
15	PDB:5mzhB	0.521	0.564	6.003E-14	415	0.150	0.164	5mzhB.pdb.gz
16	PDB:7r5jS0	0.550	0.750	9.592E-14	322	0.139	0.196	7r5jS0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
17	PDB:5o9zL	0.562	0.555	1.121E-13	459	0.124	0.122	5o9zL.pdb.gz	Cryo-EM Structure of a Pre-catalytic Human Spliceosome Primed for Activation.
18	PDB:7mqaLO	0.433	0.253	1.455E-13	819	0.135	0.074	7mqaLO.pdb.gz	Nucleolar maturation of the human small subunit processome.
19	PDB:6elzm	0.533	0.382	1.533E-13	645	0.130	0.091	6elzm.pdb.gz	Visualizing the Assembly Pathway of Nucleolar Pre-60S Ribosomes.
20	PDB:6bk8D	0.556	0.690	1.989E-13	359	0.110	0.139	6bk8D.pdb.gz	Structure of the yeast spliceosomal postcatalytic P complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A2BG80	0.0	841	448	0.874	0.884	A2BG80_DANRE Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B OS=Danio rerio OX=7955 GN=MDS026 PE=1 SV=3
2	G5EDR3	0.0	600	495	0.653	0.598	2AB1_CAEEL Serine/threonine-protein phosphatase 2A regulatory subunit sur-6 OS=Caenorhabditis elegans OX=6239 GN=sur-6 PE=1 SV=1
3	P36872	0.0	751	499	0.770	0.699	2ABA_DROME Protein phosphatase PP2A 55 kDa regulatory subunit OS=Drosophila melanogaster OX=7227 GN=tws PE=2 SV=1
4	P36876	0.0	848	447	0.881	0.893	2ABA_RAT Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform OS=Rattus norvegicus OX=10116 GN=Ppp2r2a PE=2 SV=1
5	P36877	0.0	798	443	0.821	0.840	2ABB_RAT Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B beta isoform OS=Rattus norvegicus OX=10116 GN=Ppp2r2b PE=1 SV=2
6	P56932	0.0	925	453	0.967	0.967	2ABD_RAT Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B delta isoform OS=Rattus norvegicus OX=10116 GN=Ppp2r2d PE=2 SV=1
7	P63151	0.0	848	447	0.879	0.890	2ABA_HUMAN Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform OS=Homo sapiens OX=9606 GN=PPP2R2A PE=1 SV=1
8	Q00005	0.0	800	443	0.821	0.840	2ABB_HUMAN Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B beta isoform OS=Homo sapiens OX=9606 GN=PPP2R2B PE=1 SV=1
9	Q66LE6	0.0	948	453	1.000	1.000	2ABD_HUMAN Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B delta isoform OS=Homo sapiens OX=9606 GN=PPP2R2D PE=1 SV=1
10	Q6IRD3	0.0	823	444	0.857	0.874	Q6IRD3_XENLA Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B OS=Xenopus laevis OX=8355 GN=ppp2r2a.S PE=1 SV=1
11	Q6NY64	0.0	891	447	0.940	0.953	2ABD_DANRE Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B delta isoform OS=Danio rerio OX=7955 GN=ppp2r2d PE=2 SV=1
12	Q6P1F6	0.0	848	447	0.879	0.890	2ABA_MOUSE Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform OS=Mus musculus OX=10090 GN=Ppp2r2a PE=1 SV=1
13	Q6PGU9	0.0	835	448	0.870	0.879	Q6PGU9_DANRE Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B OS=Danio rerio OX=7955 GN=ppp2r2d PE=1 SV=1
14	Q7ZX64	0.0	890	447	0.934	0.946	2ABD_XENLA Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B delta isoform OS=Xenopus laevis OX=8355 GN=ppp2r2d PE=1 SV=1
15	Q9Y2T4	0.0	780	447	0.795	0.805	2ABG_HUMAN Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B gamma isoform OS=Homo sapiens OX=9606 GN=PPP2R2C PE=1 SV=4
16	X1WDS4	0.0	756	446	0.770	0.783	X1WDS4_DANRE Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B OS=Danio rerio OX=7955 GN=ppp2r2aa PE=1 SV=1
17	C8VMY3	2.29e-177	506	472	0.581	0.557	C8VMY3_EMENI Protein phosphatase PP2A regulatory subunit B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_01545 PE=3 SV=1
18	Q12702	1.77e-175	501	463	0.574	0.562	2ABA_SCHPO Protein phosphatase PP2A regulatory subunit B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pab1 PE=1 SV=2
19	Q39247	1.60e-163	472	501	0.554	0.501	2ABB_ARATH Serine/threonine protein phosphatase 2A 55 kDa regulatory subunit B beta isoform OS=Arabidopsis thaliana OX=3702 GN=PP2AB2 PE=1 SV=1
20	Q54Q99	1.01e-159	462	483	0.530	0.497	PH2AB_DICDI Serine/threonine-protein phosphatase 2A regulatory subunit phr2AB OS=Dictyostelium discoideum OX=44689 GN=phr2aB PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12894 ANAPC4_WD40	3.8	19.2	Anaphase-promoting complex subunit 4 WD40 domain
2	PF00400 WD40	0.00012	33.9	WD domain, G-beta repeat
3	PF03162 Y_phosphatase2	60	14.7	Tyrosine phosphatase family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000399970

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000324804	0.999	Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform
2	9606.ENSP00000418447	0.999	Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform
3	9606.ENSP00000377036	0.998	Serine/threonine-protein phosphatase 2A activator
4	9606.ENSP00000221138	0.996	Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform
5	9606.ENSP00000311344	0.993	Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform
6	9606.ENSP00000325074	0.975	Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform
7	9606.ENSP00000341743	0.970	Alpha-endosulfine
8	9606.ENSP00000417963	0.970	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit delta isoform
9	9606.ENSP00000455625	0.970	cAMP-regulated phosphoprotein 19
10	9606.ENSP00000261461	0.954	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit alpha isoform
11	9606.ENSP00000365107	0.952	Serine/threonine-protein kinase greatwall
12	9606.ENSP00000264977	0.929	Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit alpha
13	9606.ENSP00000412324	0.924	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit gamma isoform
14	9606.ENSP00000279387	0.916	Serine/threonine-protein phosphatase 4 catalytic subunit
15	9606.ENSP00000375080	0.907	Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit beta
16	9606.ENSP00000164133	0.905	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit beta isoform
17	9606.ENSP00000381461	0.902	Protein phosphatase methylesterase 1
18	9606.ENSP00000337641	0.889	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit epsilon isoform
19	9606.ENSP00000305924	0.877	Serine/threonine-protein phosphatase 4 regulatory subunit 4
20	9606.ENSP00000383402	0.877	Serine/threonine-protein phosphatase 4 regulatory subunit 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0098772	0.949	molecular function regulator activity
GO:0019208	0.930	phosphatase regulator activity
GO:0019888	0.920	protein phosphatase regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0048856	0.956	anatomical structure development
GO:0003158	0.946	endothelium development
GO:0050789	0.892	regulation of biological process
GO:0050794	0.877	regulation of cellular process
GO:0003159	0.861	morphogenesis of an endothelium
GO:0032501	0.853	multicellular organismal process
GO:0071840	0.804	cellular component organization or biogenesis
GO:0008152	0.748	metabolic process
GO:0016043	0.736	cellular component organization
GO:0050896	0.730	response to stimulus
GO:0007275	0.714	multicellular organism development
GO:0071704	0.713	organic substance metabolic process
GO:0048646	0.707	anatomical structure formation involved in morphogenesis
GO:0035295	0.704	tube development
GO:0140253	0.686	cell-cell fusion
GO:0061154	0.664	endothelial tube morphogenesis
GO:0044238	0.639	primary metabolic process
GO:0044237	0.615	cellular metabolic process
GO:0006807	0.599	nitrogen compound metabolic process
GO:0006949	0.550	syncytium formation
GO:0043170	0.542	macromolecule metabolic process
GO:0001944	0.521	vasculature development
GO:0048518	0.503	positive regulation of biological process
GO:1901564	0.489	organonitrogen compound metabolic process
GO:0048514	0.474	blood vessel morphogenesis
GO:0043412	0.465	macromolecule modification
GO:0030154	0.463	cell differentiation
GO:0019538	0.451	protein metabolic process
GO:0019222	0.434	regulation of metabolic process
GO:0080090	0.386	regulation of primary metabolic process
GO:0036211	0.324	protein modification process
GO:0007049	0.303	cell cycle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005829	0.998	cytosol
GO:0005654	0.988	nucleoplasm
GO:0032991	0.962	protein-containing complex
GO:0008287	0.776	protein serine/threonine phosphatase complex
GO:0000159	0.474	protein phosphatase type 2A complex
GO:0016020	0.332	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]