StarFunc result for job id Q674X7

User Input

>input (775 residues)
MMEDNKQLALRIDGAVQSASQEVTNLRAELTATNRRLAELSGGGGPGPGPGAAASASAAG
DSAATNMENPQLGAQVLLREEVSRLQEEVHLLRQMKEMLAKDLEESQGGKSSEVLSATEL
RVQLAQKEQELARAKEALQAMKADRKRLKGEKTDLVSQMQQLYATLESREEQLRDFIRNY
EQHRKESEDAVKALAKEKDLLEREKWELRRQAKEATDHATALRSQLDLKDNRMKELEAEL
AMAKQSLATLTKDVPKRHSLAMPGETVLNGNQEWVVQADLPLTAAIRQSQQTLYHSHPPH
PADRQAVRVSPCHSRQPSVISDASAAEGDRSSTPSDINSPRHRTHSLCNGDSPGPVQKNL
HNPIVQSLEDLEDQKRKKKKEKMGFGSISRVFARGKQRKSLDPGLFDDSDSQCSPTRQSL
SLSEGEEQMDRLQQVELVRTTPMSHWKAGTVQAWLEVVMAMPMYVKACTENVKSGKVLLS
LSDEDLQLGLGVCSSLHRRKLRLAIEDYRDAEAGRSLSKAAELDHHWVAKAWLNDIGLSQ
YSQAFQNHLVDGRMLNSLMKRDLEKHLNVSKKFHQVSILLGIELLYQVNFSREALQERRA
RCETQNIDPVVWTNQRVLKWVRDIDLKEYADNLTNSGVHGAVLVLEPTFNAEAMATALGI
PSGKHILRRHLAEEMSAVFHPANSTGIREAERFGTPPGRASSVTRAGKEENSSGLKYKAG
RLPLGKIGRGFSSKDPDFHDDYGSLQNEDCGDDDPQSRLEQCRLEGYNSLEVTNV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0B4LG34	0.344	0.249	1.977E-32	1082	0.332	0.238	A0A0B4LG34.pdb.gz	A0A0B4LG34_DROME Liprin-gamma, isoform E OS=Drosophila melanogaster OX=7227 GN=Liprin-gamma PE=4 SV=1
2	AFDB:X1WCJ5	0.312	0.201	3.822E-26	1226	0.293	0.185	X1WCJ5.pdb.gz	X1WCJ5_DANRE Liprin-alpha-3 isoform X1 OS=Danio rerio OX=7955 GN=ppfia3 PE=3 SV=1
3	AFDB:Q69ZW5	0.326	0.225	5.427E-26	1140	0.283	0.192	Q69ZW5.pdb.gz	Q69ZW5_MOUSE MKIAA0897 protein (Fragment) OS=Mus musculus OX=10090 GN=Ppfia4 PE=2 SV=1
4	AFDB:F1M8A4	0.318	0.217	7.706E-26	1150	0.253	0.170	F1M8A4.pdb.gz	F1M8A4_RAT PTPRF interacting protein alpha 2 OS=Rattus norvegicus OX=10116 GN=Ppfia2 PE=1 SV=3
5	AFDB:B8QI33	0.338	0.209	1.337E-25	1267	0.254	0.155	B8QI33.pdb.gz	B8QI33_MOUSE Liprin-alpha 1 OS=Mus musculus OX=10090 GN=Ppfia1 PE=2 SV=1
6	AFDB:Q13136	0.324	0.212	4.231E-25	1202	0.275	0.177	Q13136.pdb.gz	LIPA1_HUMAN Liprin-alpha-1 OS=Homo sapiens OX=9606 GN=PPFIA1 PE=1 SV=1
7	AFDB:M9PCR7	0.333	0.217	4.676E-25	1205	0.237	0.153	M9PCR7.pdb.gz	M9PCR7_DROME Liprin-alpha, isoform D OS=Drosophila melanogaster OX=7227 GN=Liprin-alpha PE=1 SV=1
8	AFDB:M9PC73	0.323	0.219	9.441E-24	1158	0.276	0.185	M9PC73.pdb.gz	M9PC73_DROME Liprin-alpha, isoform C OS=Drosophila melanogaster OX=7227 GN=Liprin-alpha PE=1 SV=1
9	AFDB:A0A0G2K383	0.308	0.248	3.154E-20	970	0.241	0.193	A0A0G2K383.pdb.gz	A0A0G2K383_RAT PPFIA binding protein 2 OS=Rattus norvegicus OX=10116 GN=Ppfibp2 PE=1 SV=1
10	AFDB:Q7Z3H4	0.091	0.155	6.509E-3	446	0.057	0.099	Q7Z3H4.pdb.gz	SAMD7_HUMAN Sterile alpha motif domain-containing protein 7 OS=Homo sapiens OX=9606 GN=SAMD7 PE=1 SV=1
11	PDB:7anwA	0.088	0.100	2.228E-2	645	0.059	0.071	7anwA.pdb.gz	Structural basis for SARM1 inhibition and activation under energetic stress.
12	PDB:6wpkA	0.089	0.117	1.052E-1	547	0.040	0.057	6wpkA.pdb.gz
13	PDB:7cm7A	0.089	0.104	1.352E-1	620	0.054	0.068	7cm7A.pdb.gz	The NAD + -mediated self-inhibition mechanism of pro-neurodegenerative SARM1.
14	PDB:3bs5A	0.078	0.565	2.018E-1	86	0.025	0.221	3bs5A.pdb.gz
15	PDB:6brhB	0.085	0.129	2.231E-1	502	0.049	0.076	6brhB.pdb.gz	The SAM domain of mouse SAMHD1 is critical for its activation and regulation.
16	PDB:6mzcI	0.073	0.131	1.922	339	0.039	0.088	6mzcI.pdb.gz
17	PDB:7zs9M	0.088	0.179	1.922	310	0.036	0.090	7zs9M.pdb.gz	Structures of transcription preinitiation complex engaged with the +1 nucleosome.
18	PDB:6yvvB	0.042	0.060	2.349	480	0.050	0.081	6yvvB.pdb.gz
19	PDB:6hb3B	0.107	0.180	3.017	360	0.045	0.097	6hb3B.pdb.gz
20	PDB:2qb0B	0.080	0.232	3.172	241	0.041	0.133	2qb0B.pdb.gz	Polymer-driven crystallization.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A1B0GWK2	0.0	1599	863	1.000	0.898	A0A1B0GWK2_HUMAN Kazrin, periplakin interacting protein OS=Homo sapiens OX=9606 GN=KAZN PE=1 SV=1
2	Q674X7	0.0	1595	775	1.000	1.000	KAZRN_HUMAN Kazrin OS=Homo sapiens OX=9606 GN=KAZN PE=1 SV=2
3	A8DYM1	1.18e-86	294	852	0.196	0.178	A8DYM1_DROME Liprin-gamma, isoform D OS=Drosophila melanogaster OX=7227 GN=Liprin-gamma PE=4 SV=1
4	A0A0B4LG34	2.22e-86	297	1082	0.199	0.142	A0A0B4LG34_DROME Liprin-gamma, isoform E OS=Drosophila melanogaster OX=7227 GN=Liprin-gamma PE=4 SV=1
5	Q9W263	2.67e-86	296	1023	0.199	0.151	Q9W263_DROME Liprin-gamma, isoform A OS=Drosophila melanogaster OX=7227 GN=Liprin-gamma PE=4 SV=2
6	A8DYM0	5.21e-86	297	1152	0.199	0.134	A8DYM0_DROME Liprin-gamma, isoform C OS=Drosophila melanogaster OX=7227 GN=Liprin-gamma PE=4 SV=1
7	M9PC73	4.36e-53	201	1158	0.129	0.086	M9PC73_DROME Liprin-alpha, isoform C OS=Drosophila melanogaster OX=7227 GN=Liprin-alpha PE=1 SV=1
8	M9PCD4	4.71e-53	201	1214	0.129	0.082	M9PCD4_DROME Liprin-alpha, isoform E OS=Drosophila melanogaster OX=7227 GN=Liprin-alpha PE=1 SV=1
9	M9PCR7	4.79e-53	201	1205	0.129	0.083	M9PCR7_DROME Liprin-alpha, isoform D OS=Drosophila melanogaster OX=7227 GN=Liprin-alpha PE=1 SV=1
10	Q9VM93	5.36e-53	201	1201	0.129	0.083	Q9VM93_DROME LD33094p OS=Drosophila melanogaster OX=7227 GN=Liprin-alpha PE=1 SV=2
11	Q21049	1.35e-52	200	1139	0.145	0.098	LIPA_CAEEL Liprin-alpha OS=Caenorhabditis elegans OX=6239 GN=syd-2 PE=1 SV=1
12	Q13136	1.32e-50	194	1202	0.120	0.077	LIPA1_HUMAN Liprin-alpha-1 OS=Homo sapiens OX=9606 GN=PPFIA1 PE=1 SV=1
13	A0A0G2K3L9	2.07e-50	193	1142	0.119	0.081	A0A0G2K3L9_RAT PTPRF interacting protein alpha 1 OS=Rattus norvegicus OX=10116 GN=Ppfia1 PE=1 SV=2
14	D3ZZ81	2.82e-50	193	1190	0.119	0.077	D3ZZ81_RAT PTPRF interacting protein alpha 1 OS=Rattus norvegicus OX=10116 GN=Ppfia1 PE=1 SV=1
15	X1WCJ5	4.56e-50	192	1226	0.133	0.084	X1WCJ5_DANRE Liprin-alpha-3 isoform X1 OS=Danio rerio OX=7955 GN=ppfia3 PE=3 SV=1
16	O75145	2.09e-49	190	1194	0.169	0.110	LIPA3_HUMAN Liprin-alpha-3 OS=Homo sapiens OX=9606 GN=PPFIA3 PE=1 SV=3
17	Q91Z79	3.25e-49	190	1192	0.133	0.086	LIPA3_RAT Liprin-alpha-3 OS=Rattus norvegicus OX=10116 GN=Ppfia3 PE=1 SV=2
18	P60469	6.53e-49	189	1194	0.133	0.086	LIPA3_MOUSE Liprin-alpha-3 OS=Mus musculus OX=10090 GN=Ppfia3 PE=1 SV=2
19	A0A087WPJ3	1.23e-47	184	892	0.119	0.103	A0A087WPJ3_MOUSE Protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF),-interacting protein (liprin), alpha 4 (Fragment) OS=Mus musculus OX=10090 GN=Ppfia4 PE=1 SV=1
20	Q69ZW5	1.98e-47	184	1140	0.119	0.081	Q69ZW5_MOUSE MKIAA0897 protein (Fragment) OS=Mus musculus OX=10090 GN=Ppfia4 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02520 ANIS5_cation-bd	14	17.2	SXP/RAL-2 family protein Ani s 5-like, metal-binding domain
2	PF06818 Fez1	6e+02	12.2	Fez1
3	PF18386 ROQ_II	2.5e+02	12.9	Roquin II domain
4	PF00536 SAM_1	5.7e-24	95.7	SAM domain (Sterile alpha motif)
5	PF07647 SAM_2	8.9e-26	101.1	SAM domain (Sterile alpha motif)
6	PF13543 SAM_KSR1	9.2e+02	11.4	SAM like domain present in kinase suppressor RAS 1
7	PF02198 SAM_PNT	8.4	17.8	Sterile alpha motif (SAM)/Pointed domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000365198

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000340510	0.957	Periplakin
2	9606.ENSP00000263207	0.805	Armadillo repeat protein deleted in velo-cardio-facial syndrome
3	9606.ENSP00000263946	0.726	Plakophilin-1
4	9606.ENSP00000301607	0.690	Envoplakin
5	9606.ENSP00000374409	0.684	Plakophilin-4
6	9606.ENSP00000371897	0.663	Rho GTPase-activating protein 5
7	9606.ENSP00000331678	0.658	Plakophilin-3
8	9606.ENSP00000382004	0.562	Catenin delta-1
9	9606.ENSP00000357943	0.558	Annexin A9
10	9606.ENSP00000299492	0.516	Liprin-beta-2
11	9606.ENSP00000314724	0.511	Liprin-beta-1
12	9606.ENSP00000263934	0.500	Kinesin-like protein KIF1B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.991	regulation of cellular process
GO:0009987	0.987	cellular process
GO:0007154	0.538	cell communication
GO:0065008	0.408	regulation of biological quality
GO:0071840	0.395	cellular component organization or biogenesis
GO:0032502	0.378	developmental process
GO:0048856	0.373	anatomical structure development
GO:0016043	0.372	cellular component organization
GO:0032501	0.354	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.996	cytosol
GO:0005634	0.996	nucleus
GO:0070013	0.993	intracellular organelle lumen
GO:0016020	0.980	membrane
GO:0005654	0.979	nucleoplasm
GO:0005886	0.973	plasma membrane
GO:0005911	0.808	cell-cell junction
GO:0001533	0.588	cornified envelope
GO:0016604	0.539	nuclear body
GO:0016607	0.506	nuclear speck
GO:0030057	0.322	desmosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]