StarFunc result for job id Q67FW5

User Input

>input (361 residues)
MSGAGVGGASEESQAMQAHVSIILPVHNAEPWLDECLRSVLQQDFEGTMELSVFNDASKD
KSGAIIEKWRVKLEDSGVHVIIGGHDSPSPRGVGYAKNQAVAQSSGSYLCFLDSDDVMMP
QRVRLQHEAAVQHPSSIIGCRVRRDPPNSTERYTRWINQLTPEQLLTQVFTSNGPTVIMP
TWFCSRAWFSHVGPFNEGGQGVPEDLLFFYEHLRKGGGVIRVDQSLLLYRHHPQAATHCV
LETTIWTHRVRFLEEQALPRWAAFTIWNAGKQGRRLYRSLTAGSQRKVVAFCDVDENKIR
KGFYCHEDSQERPKPRIPILHFRAARPPFVICVKLDLTGGAFEDNLRSLHLQEGQDFLHF
S

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9HUG5	0.529	0.639	3.667E-16	294	0.147	0.180	Q9HUG5.pdb.gz	Q9HUG5_PSEAE Alpha-1,3-rhamnosyltransferase WapR OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=wapR PE=4 SV=1
2	AFDB:Q9I5M1	0.512	0.609	1.250E-14	299	0.163	0.197	Q9I5M1.pdb.gz	Q9I5M1_PSEAE Alpha-1,6-rhamnosyltransferase MigA OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=migA PE=4 SV=1
3	AFDB:P9WLV5	0.458	0.477	1.933E-13	346	0.147	0.153	P9WLV5.pdb.gz	Y1520_MYCTU Uncharacterized protein Rv1520 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv1520 PE=1 SV=1
4	AFDB:P9WMX7	0.471	0.645	4.815E-13	256	0.136	0.191	P9WMX7.pdb.gz	GLTR1_MYCTU PGL/p-HBAD biosynthesis glycosyltransferase Rv2957 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv2957 PE=1 SV=1
5	AFDB:P77414	0.502	0.634	6.142E-13	279	0.125	0.161	P77414.pdb.gz	WCAA_ECOLI Putative colanic acid biosynthesis glycosyl transferase WcaA OS=Escherichia coli (strain K12) OX=83333 GN=wcaA PE=4 SV=1
6	AFDB:P9WLV9	0.548	0.614	7.372E-13	319	0.158	0.179	P9WLV9.pdb.gz	Y1518_MYCTU Uncharacterized protein Rv1518 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv1518 PE=4 SV=1
7	AFDB:Q9I4V9	0.496	0.538	7.372E-13	330	0.133	0.145	Q9I4V9.pdb.gz	Q9I4V9_PSEAE Probable glycosyl transferase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=PA1014 PE=4 SV=1
8	AFDB:Q54QG0	0.535	0.267	1.626E-12	769	0.147	0.069	Q54QG0.pdb.gz	PGFB_DICDI Bifunctional glycosyltransferase pgtA OS=Dictyostelium discoideum OX=44689 GN=pgtA PE=1 SV=1
9	AFDB:P75905	0.522	0.434	2.645E-12	441	0.122	0.100	P75905.pdb.gz	PGAC_ECOLI Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Escherichia coli (strain K12) OX=83333 GN=pgaC PE=1 SV=1
10	AFDB:A0A0H3MF55	0.528	0.680	2.811E-12	275	0.097	0.127	A0A0H3MF55.pdb.gz	A0A0H3MF55_ECO7I UDP-Gal:GlcNAc alpha-pyrophosphate-R beta 1, 3-galactosyltransferase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) OX=585057 GN=wbbD PE=4 SV=1
11	PDB:4d11C	0.469	0.395	1.686E-9	436	0.114	0.094	4d11C.pdb.gz	Substrate-Guided Front-Face Reaction Revealed by Combined Structural Snapshots and Metadynamics for the Polypeptide N- Acetylgalactosaminyltransferase 2.
12	PDB:4d0tA	0.466	0.348	2.285E-9	496	0.108	0.079	4d0tA.pdb.gz	Substrate-Guided Front-Face Reaction Revealed by Combined Structural Snapshots and Metadynamics for the Polypeptide N-Acetylgalactosaminyltransferase 2.
13	PDB:6pxuB	0.466	0.329	3.951E-9	532	0.144	0.098	6pxuB.pdb.gz	The structure of the colorectal cancer-associated enzyme GalNAc-T12 reveals how nonconserved residues dictate its function.
14	PDB:2d7iA	0.485	0.339	8.201E-9	536	0.119	0.080	2d7iA.pdb.gz	Structural basis of carbohydrate transfer activity by human UDP-GalNAc: polypeptide alpha-N-acetylgalactosaminyltransferase (pp-GalNAc-T10)
15	PDB:6iwqA	0.455	0.311	9.262E-9	546	0.105	0.070	6iwqA.pdb.gz	Structural basis of carbohydrate transfer activity of UDP-GalNAc: Polypeptide N-acetylgalactosaminyltransferase 7.
16	PDB:6h0bB	0.475	0.340	1.112E-8	521	0.116	0.081	6h0bB.pdb.gz	Structural and Mechanistic Insights into the Catalytic-Domain-Mediated Short-Range Glycosylation Preferences of GalNAc-T4.
17	PDB:4decA	0.444	0.545	3.356E-7	284	0.122	0.155	4decA.pdb.gz	Mechanistic insights into the retaining glucosyl-3-phosphoglycerate synthase from mycobacteria.
18	PDB:5mlzA	0.437	0.443	4.028E-7	355	0.111	0.113	5mlzA.pdb.gz	Structural basis for dolichylphosphate mannose biosynthesis.
19	PDB:4hg6A	0.424	0.223	5.460E-7	747	0.080	0.039	4hg6A.pdb.gz	Crystallographic snapshot of cellulose synthesis and membrane translocation.
20	PDB:7msnA	0.350	0.308	1.066E-6	417	0.091	0.079	7msnA.pdb.gz	Structural and mechanistic investigations of protein S-glycosyltransferases.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q56914	5.55e-13	71.2	318	0.105	0.119	Q56914_YEREN WbcK protein OS=Yersinia enterocolitica OX=630 GN=wbcK PE=4 SV=1
2	Q9I5M1	1.72e-09	60.5	299	0.102	0.124	Q9I5M1_PSEAE Alpha-1,6-rhamnosyltransferase MigA OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=migA PE=4 SV=1
3	Q0P9C6	1.03e-07	55.1	309	0.089	0.104	PGLI_CAMJE GalNAc(5)-diNAcBac-PP-undecaprenol beta-1,3-glucosyltransferase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) OX=192222 GN=pglI PE=1 SV=1
4	Q9HUG5	2.44e-06	50.8	294	0.161	0.197	Q9HUG5_PSEAE Alpha-1,3-rhamnosyltransferase WapR OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=wapR PE=4 SV=1
5	P75302	2.90e-06	50.8	341	0.078	0.082	PBDGT_MYCPN Processive diacylglycerol beta-glycosyltransferase OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1) OX=272634 GN=MPN_483 PE=1 SV=1
6	Q54Q41	3.19e-06	51.6	1065	0.094	0.032	Q54Q41_DICDI Glycosyltransferase OS=Dictyostelium discoideum OX=44689 GN=pgtC PE=4 SV=1
7	Q9ZB73	1.16e-05	48.9	341	0.072	0.076	PBDGT_MYCGE Processive diacylglycerol beta-glycosyltransferase OS=Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37) OX=243273 GN=MG335.2 PE=1 SV=1
8	Q9I4V9	1.60e-05	48.5	330	0.100	0.109	Q9I4V9_PSEAE Probable glycosyl transferase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=PA1014 PE=4 SV=1
9	P11290	2.15e-05	48.1	344	0.080	0.084	YIBD_ECOLI Uncharacterized glycosyltransferase YibD OS=Escherichia coli (strain K12) OX=83333 GN=yibD PE=3 SV=2
10	Q56915	2.32e-05	47.8	292	0.091	0.113	Q56915_YEREN Glycosyltransferase family 2 protein OS=Yersinia enterocolitica OX=630 GN=wbcL PE=4 SV=1
11	Q38BE0	6.71e-04	43.1	259	0.102	0.143	Q38BE0_TRYB2 Dolichol-phosphate mannosyltransferase subunit 1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.2610 PE=3 SV=1
12	P9WMX7	0.001	42.4	256	0.133	0.188	GLTR1_MYCTU PGL/p-HBAD biosynthesis glycosyltransferase Rv2957 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv2957 PE=1 SV=1
13	P77414	0.002	42.0	279	0.078	0.100	WCAA_ECOLI Putative colanic acid biosynthesis glycosyl transferase WcaA OS=Escherichia coli (strain K12) OX=83333 GN=wcaA PE=4 SV=1
14	B3VA59	0.003	41.6	321	0.061	0.069	AGLC_METVO Dolichyl N-acetyl-alpha-D-glucosaminyl phosphate 3-beta-D-2,3-diacetamido-2,3-dideoxy-beta-D-glucuronosyltransferase OS=Methanococcus voltae OX=2188 GN=aglC PE=1 SV=1
15	P75905	0.008	40.4	441	0.083	0.068	PGAC_ECOLI Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Escherichia coli (strain K12) OX=83333 GN=pgaC PE=1 SV=1
16	Q8PHY8	0.082	37.4	732	0.078	0.038	Q8PHY8_XANAC Glycosyltransferase OS=Xanthomonas axonopodis pv. citri (strain 306) OX=190486 GN=XAC3110 PE=4 SV=1
17	P9WLV5	0.22	35.8	346	0.139	0.145	Y1520_MYCTU Uncharacterized protein Rv1520 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv1520 PE=1 SV=1
18	F4IP13	0.66	34.7	1716	0.047	0.010	SHGR6_ARATH Protein SHOOT GRAVITROPISM 6 OS=Arabidopsis thaliana OX=3702 GN=SGR6 PE=2 SV=1
19	Q8MYY6	0.76	34.3	558	0.130	0.084	GLT13_DROME Putative polypeptide N-acetylgalactosaminyltransferase 13 OS=Drosophila melanogaster OX=7227 GN=pgant13 PE=2 SV=2
20	P0AFK9	1.5	33.1	348	0.050	0.052	POTD_ECOLI Spermidine/putrescine-binding periplasmic protein OS=Escherichia coli (strain K12) OX=83333 GN=potD PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00535 Glycos_transf_2	2.8e-20	84.3	Glycosyl transferase family 2
2	PF10111 Glyco_tranf_2_2	18	16.2	Glycosyltransferase like family 2
3	PF13641 Glyco_tranf_2_3	6.4e-06	37.7	Glycosyltransferase like family 2
4	PF13704 Glyco_tranf_2_4	0.47	22.4	Glycosyl transferase family 2

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000319979

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000417498	0.905	Mucin-4
2	9606.ENSP00000302716	0.900	Mucin-17
3	9606.ENSP00000311364	0.900	Mucin-like protein 1
4	9606.ENSP00000365473	0.900	Mucin-21
5	9606.ENSP00000368771	0.900	Mucin-3A
6	9606.ENSP00000381008	0.900	Mucin-16
7	9606.ENSP00000406861	0.900	Mucin-6
8	9606.ENSP00000407422	0.900	Mucin-7
9	9606.ENSP00000414350	0.900	Mucin-20
10	9606.ENSP00000416753	0.900	Mucin-15
11	9606.ENSP00000436812	0.900	Mucin-5B
12	9606.ENSP00000441929	0.900	Mucin-12
13	9606.ENSP00000484824	0.900	Mucin-1
14	9606.ENSP00000485028	0.900	Mucin-13
15	9606.ENSP00000485659	0.900	Mucin-5AC
16	9606.ENSP00000380793	0.883	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase
17	9606.ENSP00000333813	0.853	Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase
18	9606.ENSP00000347719	0.798	Tubulin-specific chaperone D
19	9606.ENSP00000269373	0.780	Ketosamine-3-kinase
20	9606.ENSP00000315731	0.741	Meteorin-like protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0016758	1.000	hexosyltransferase activity
GO:0008194	0.811	UDP-glycosyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.995	organic substance metabolic process
GO:0044237	0.995	cellular metabolic process
GO:0044238	0.983	primary metabolic process
GO:0006807	0.943	nitrogen compound metabolic process
GO:1901135	0.908	carbohydrate derivative metabolic process
GO:0009058	0.874	biosynthetic process
GO:1901576	0.835	organic substance biosynthetic process
GO:0043170	0.777	macromolecule metabolic process
GO:1901564	0.765	organonitrogen compound metabolic process
GO:0044249	0.705	cellular biosynthetic process
GO:1901137	0.492	carbohydrate derivative biosynthetic process
GO:0009100	0.480	glycoprotein metabolic process
GO:0009059	0.455	macromolecule biosynthetic process
GO:0065007	0.437	biological regulation
GO:0034645	0.381	cellular macromolecule biosynthetic process
GO:1901566	0.369	organonitrogen compound biosynthetic process
GO:0009101	0.348	glycoprotein biosynthetic process
GO:0043412	0.319	macromolecule modification
GO:0050789	0.316	regulation of biological process
GO:0050794	0.312	regulation of cellular process
GO:0070085	0.301	glycosylation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005829	0.979	cytosol
GO:0043227	0.931	membrane-bounded organelle
GO:0043231	0.845	intracellular membrane-bounded organelle
GO:0016020	0.799	membrane
GO:0012505	0.728	endomembrane system
GO:0005576	0.612	extracellular region
GO:0070062	0.548	extracellular exosome
GO:0070013	0.308	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.4.1.-	1.000	Hexosyltransferases.

[back to server]