StarFunc result for job id Q684P5

User Input

>input (730 residues)
MFGRKRSVSFGGFGWIDKTMLASLKVKKQELANSSDATLPDRPLSPPLTAPPTMKSSEFF
EMLEKMQGIKLEEQKPGPQKNKDDYIPYPSIDEVVEKGGPYPQVILPQFGGYWIEDPENV
GTPTSLGSSICEEEEEDNLSPNTFGYKLECKGEARAYRRHFLGKDHLNFYCTGSSLGNLI
LSVKCEEAEGIEYLRVILRSKLKTVHERIPLAGLSKLPSVPQIAKAFCDDAVGLRFNPVL
YPKASQMIVSYDEHEVNNTFKFGVIYQKARQTLEEELFGNNEESPAFKEFLDLLGDTITL
QDFKGFRGGLDVTHGQTGVESVYTTFRDREIMFHVSTKLPFTDGDAQQLQRKRHIGNDIV
AIIFQEENTPFVPDMIASNFLHAYIVVQVETPGTETPSYKVSVTAREDVPTFGPPLPSPP
VFQKGPEFREFLLTKLTNAENACCKSDKFAKLEDRTRAALLDNLHDELHAHTQAMLGLGP
EEDKFENGGHGGFLESFKRAIRVRSHSMETMVGGQKKSHSGGIPGSLSGGISHNSMEVTK
TTFSPPVVAATVKNQSRSPIKRRSGLFPRLHTGSEGQGDSRARCDSTSSTPKTPDGGHSS
QEIKSETSSNPSSPEICPNKEKPFMKLKENGRAISRSSSSTSSVSSTAGEGEAMEEGDSG
GSQPSTTSPFKQEVFVYSPSPSSESPSLGAAATPIIMSRSPTDAKSRNSPRSNLKFRFDK
LSHASSGAGH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A1B0GV05	0.571	0.541	0.000	771	0.981	0.929	A0A1B0GV05.pdb.gz	A0A1B0GV05_HUMAN RAP1 GTPase activating protein 2 OS=Homo sapiens OX=9606 GN=RAP1GAP2 PE=1 SV=1
2	AFDB:Q54Q75	0.409	0.776	4.657E-34	366	0.167	0.333	Q54Q75.pdb.gz	Q54Q75_DICDI RapGAP/RanGAP domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0284065 PE=4 SV=1
3	AFDB:A0A2R8RNK4	0.418	0.188	6.165E-34	1718	0.277	0.118	A0A2R8RNK4.pdb.gz
4	AFDB:Q8C0T5	0.442	0.191	1.996E-32	1782	0.285	0.117	Q8C0T5.pdb.gz	SI1L1_MOUSE Signal-induced proliferation-associated 1-like protein 1 OS=Mus musculus OX=10090 GN=Sipa1l1 PE=1 SV=2
5	AFDB:O43166	0.427	0.182	5.479E-32	1804	0.271	0.110	O43166.pdb.gz	SI1L1_HUMAN Signal-induced proliferation-associated 1-like protein 1 OS=Homo sapiens OX=9606 GN=SIPA1L1 PE=1 SV=4
6	AFDB:O35412	0.417	0.177	1.202E-31	1822	0.273	0.109	O35412.pdb.gz	SI1L1_RAT Signal-induced proliferation-associated 1-like protein 1 OS=Rattus norvegicus OX=10116 GN=Sipa1l1 PE=1 SV=1
7	PDB:7dl2B	0.218	0.160	2.007E-12	1042	0.079	0.056	7dl2B.pdb.gz
8	PDB:7dl2A	0.216	0.151	5.811E-11	1127	0.071	0.046	7dl2A.pdb.gz
9	AFDB:Q6P1D7	0.071	0.042	4.252E-2	1565	0.142	0.066	Q6P1D7.pdb.gz	SLX4_MOUSE Structure-specific endonuclease subunit SLX4 OS=Mus musculus OX=10090 GN=Slx4 PE=1 SV=1
10	AFDB:O35569	0.065	0.057	1.545E-1	868	0.132	0.111	O35569.pdb.gz	NRG2_RAT Pro-neuregulin-2, membrane-bound isoform OS=Rattus norvegicus OX=10116 GN=Nrg2 PE=1 SV=1
11	AFDB:A2VDJ0	0.062	0.035	3.028E-1	1609	0.122	0.055	A2VDJ0.pdb.gz	T131L_HUMAN Transmembrane protein 131-like OS=Homo sapiens OX=9606 GN=TMEM131L PE=1 SV=2
12	PDB:7b9kA	0.076	0.128	3.047E-1	320	0.058	0.131	7b9kA.pdb.gz
13	PDB:2eyqA	0.051	0.035	3.606E-1	1146	0.036	0.023	2eyqA.pdb.gz
14	AFDB:Q3UH66	0.065	0.031	4.009E-1	2149	0.137	0.047	Q3UH66.pdb.gz	WNK2_MOUSE Serine/threonine-protein kinase WNK2 OS=Mus musculus OX=10090 GN=Wnk2 PE=1 SV=2
15	PDB:6x0lP	0.063	0.093	4.773E-1	474	0.014	0.021	6x0lP.pdb.gz	Bridging of DNA breaks activates PARP2-HPF1 to modify chromatin.
16	PDB:4rerA	0.057	0.080	5.974E-1	459	0.022	0.035	4rerA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
17	PDB:3kq0A	0.047	0.146	7.068E-1	175	0.004	0.017	3kq0A.pdb.gz	The 1.8-A crystal structure of alpha1-acid glycoprotein (Orosomucoid) solved by UV RIP reveals the broad drug-binding activity of this human plasma lipocalin.
18	PDB:6acaA	0.049	0.036	7.068E-1	1133	0.037	0.024	6acaA.pdb.gz
19	PDB:4p7hB	0.046	0.039	7.476E-1	952	0.027	0.021	4p7hB.pdb.gz
20	PDB:6h4nx	0.031	0.187	7.476E-1	95	0.016	0.126	6h4nx.pdb.gz	Structure of a hibernating 100S ribosome reveals an inactive conformation of the ribosomal protein S1.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A1B0GV05	0.0	1469	771	0.979	0.927	A0A1B0GV05_HUMAN RAP1 GTPase activating protein 2 OS=Homo sapiens OX=9606 GN=RAP1GAP2 PE=1 SV=1
2	A0A8I6AU92	0.0	613	694	0.478	0.503	A0A8I6AU92_RAT Rap1 GTPase-activating protein OS=Rattus norvegicus OX=10116 GN=Rap1gap PE=4 SV=1
3	A2ALS5	0.0	603	663	0.466	0.513	RPGP1_MOUSE Rap1 GTPase-activating protein 1 OS=Mus musculus OX=10090 GN=Rap1gap PE=1 SV=2
4	F1LV89	0.0	625	753	0.500	0.485	F1LV89_RAT Rap1 GTPase-activating protein OS=Rattus norvegicus OX=10116 GN=Rap1gap PE=1 SV=3
5	P47736	0.0	607	663	0.470	0.517	RPGP1_HUMAN Rap1 GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=RAP1GAP PE=1 SV=2
6	Q5SVL6	0.0	1340	712	0.916	0.940	RPGP2_MOUSE Rap1 GTPase-activating protein 2 OS=Mus musculus OX=10090 GN=Rap1gap2 PE=1 SV=1
7	Q684P5	0.0	1503	730	1.000	1.000	RPGP2_HUMAN Rap1 GTPase-activating protein 2 OS=Homo sapiens OX=9606 GN=RAP1GAP2 PE=1 SV=2
8	A0A8I5ZN32	2.26e-153	464	698	0.404	0.423	A0A8I5ZN32_RAT Rap1 GTPase-activating protein OS=Rattus norvegicus OX=10116 GN=Rap1gap PE=4 SV=1
9	Q86RS9	4.07e-138	426	741	0.304	0.300	Q86RS9_CAEEL Rap1GAP (Fragment) OS=Caenorhabditis elegans OX=6239 PE=1 SV=1
10	Q9VM02	4.78e-135	421	850	0.297	0.255	Q9VM02_DROME Rap GTPase activating protein 1, isoform E OS=Drosophila melanogaster OX=7227 GN=RapGAP1 PE=4 SV=1
11	O44090	6.24e-135	421	850	0.297	0.255	O44090_DROME GTPase activating protein for Rap1 OS=Drosophila melanogaster OX=7227 GN=RapGAP1 PE=2 SV=1
12	Q59DZ5	6.46e-135	421	876	0.297	0.248	Q59DZ5_DROME Rap GTPase activating protein 1, isoform F OS=Drosophila melanogaster OX=7227 GN=RapGAP1 PE=4 SV=1
13	H2L055	8.09e-135	419	811	0.288	0.259	H2L055_CAEEL Rap-GAP domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=CELE_F53A10.2 PE=1 SV=1
14	Q9VM00	1.31e-134	422	933	0.297	0.233	Q9VM00_DROME Rap GTPase activating protein 1, isoform D OS=Drosophila melanogaster OX=7227 GN=RapGAP1 PE=4 SV=2
15	A8DYW8	3.92e-134	422	959	0.297	0.226	A8DYW8_DROME Rap GTPase activating protein 1, isoform H OS=Drosophila melanogaster OX=7227 GN=RapGAP1 PE=4 SV=2
16	X2JBI1	1.58e-69	251	1653	0.182	0.080	X2JBI1_DROME Radish, isoform M OS=Drosophila melanogaster OX=7227 GN=rsh PE=4 SV=1
17	X2JEQ0	1.69e-69	250	1651	0.182	0.081	X2JEQ0_DROME Radish, isoform K OS=Drosophila melanogaster OX=7227 GN=rsh PE=4 SV=1
18	X2JDH0	1.74e-69	250	1799	0.210	0.085	X2JDH0_DROME Radish, isoform I OS=Drosophila melanogaster OX=7227 GN=rsh PE=4 SV=1
19	X2JF15	1.78e-69	250	1630	0.210	0.094	X2JF15_DROME Radish, isoform L OS=Drosophila melanogaster OX=7227 GN=rsh PE=4 SV=1
20	G3X9J0	2.06e-69	250	1776	0.195	0.080	SI1L3_MOUSE Signal-induced proliferation-associated 1-like protein 3 OS=Mus musculus OX=10090 GN=Sipa1l3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02145 Rap_GAP	1.2e-60	215.7	Rap/ran-GAP

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000254695

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000358723	0.955	Ras-related protein Rap-1A
2	9606.ENSP00000250559	0.951	Ras-related protein Rap-1b
3	9606.ENSP00000363092	0.925	cGMP-dependent protein kinase 1
4	9606.ENSP00000309591	0.902	cAMP-dependent protein kinase catalytic subunit alpha
5	9606.ENSP00000359719	0.902	cAMP-dependent protein kinase catalytic subunit beta
6	9606.ENSP00000366488	0.902	cAMP-dependent protein kinase catalytic subunit gamma
7	9606.ENSP00000379287	0.753	14-3-3 protein zeta/delta
8	9606.ENSP00000395708	0.747	Rap guanine nucleotide exchange factor 3
9	9606.ENSP00000380271	0.743	Rap guanine nucleotide exchange factor 4
10	9606.ENSP00000361930	0.667	14-3-3 protein beta/alpha
11	9606.ENSP00000335029	0.665	Ras GTPase-activating protein 3
12	9606.ENSP00000356047	0.573	6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2
13	9606.ENSP00000338864	0.504	RAS guanyl-releasing protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005096	1.000	GTPase activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.985	response to stimulus
GO:0050794	0.985	regulation of cellular process
GO:0009987	0.944	cellular process
GO:0071840	0.554	cellular component organization or biogenesis
GO:0016043	0.517	cellular component organization
GO:0048523	0.507	negative regulation of cellular process
GO:0065008	0.434	regulation of biological quality
GO:0002376	0.353	immune system process
GO:0051716	0.310	cellular response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0016020	0.999	membrane
GO:0005829	0.999	cytosol
GO:0012505	0.995	endomembrane system
GO:0005634	0.988	nucleus
GO:0071944	0.978	cell periphery
GO:0005886	0.942	plasma membrane
GO:0031090	0.805	organelle membrane
GO:0031975	0.784	envelope
GO:0043232	0.662	intracellular non-membrane-bounded organelle
GO:0042995	0.421	cell projection
GO:0031967	0.401	organelle envelope
GO:0120025	0.356	plasma membrane bounded cell projection
GO:0070013	0.353	intracellular organelle lumen
GO:0031981	0.342	nuclear lumen
GO:0005635	0.324	nuclear envelope
GO:0005654	0.304	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]