StarFunc result for job id Q685J3

User Input

>input (1400 residues)
MPRPGTMALCLLTLVLSLLPPQAAAEQDLSVNRAVWDGGGCISQGDVLNRQCQQLSQHVR
TGSAANTATGTTSTNVVEPRMYLSCSTNPEMTSIESSVTSDTPGVSSTRMTPTESRTTSE
STSDSTTLFPSSTEDTSSPTTPEGTDVPMSTPSEESISSTMAFVSTAPLPSFEAYTSLTY
KVDMSTPLTTSTQASSSPTTPESTTIPKSTNSEGSTPLTSMPASTMKVASSEAITLLTTP
VEISTPVTISAQASSSPTTAEGPSLSNSAPSGGSTPLTRMPLSVMLVVSSEASTLSTTPA
ATNIPVITSTEASSSPTTAEGTSIPTSTYTEGSTPLTSTPASTMPVATSEMSTLSITPVD
TSTLVTTSTEPSSLPTTAEATSMLTSTLSEGSTPLTNMPVSTILVASSEASTTSTIPVDS
KTFVTTASEASSSPTTAEDTSIATSTPSEGSTPLTSMPVSTTPVASSEASNLSTTPVDSK
TQVTTSTEASSSPPTAEVNSMPTSTPSEGSTPLTSMSVSTMPVASSEASTLSTTPVDTST
PVTTSSEASSSSTTPEGTSIPTSTPSEGSTPLTNMPVSTRLVVSSEASTTSTTPADSNTF
VTTSSEASSSSTTAEGTSMPTSTYSERGTTITSMSVSTTLVASSEASTLSTTPVDSNTPV
TTSTEATSSSTTAEGTSMPTSTYTEGSTPLTSMPVNTTLVASSEASTLSTTPVDTSTPVT
TSTEASSSPTTADGASMPTSTPSEGSTPLTSMPVSKTLLTSSEASTLSTTPLDTSTHITT
STEASCSPTTTEGTSMPISTPSEGSPLLTSIPVSITPVTSPEASTLSTTPVDSNSPVTTS
TEVSSSPTPAEGTSMPTSTYSEGRTPLTSMPVSTTLVATSAISTLSTTPVDTSTPVTNST
EARSSPTTSEGTSMPTSTPGEGSTPLTSMPDSTTPVVSSEARTLSATPVDTSTPVTTSTE
ATSSPTTAEGTSIPTSTPSEGTTPLTSTPVSHTLVANSEASTLSTTPVDSNTPLTTSTEA
SSPPPTAEGTSMPTSTPSEGSTPLTRMPVSTTMVASSETSTLSTTPADTSTPVTTYSQAS
SSSTTADGTSMPTSTYSEGSTPLTSVPVSTRLVVSSEASTLSTTPVDTSIPVTTSTEASS
SPTTAEGTSIPTSPPSEGTTPLASMPVSTTLVVSSEANTLSTTPVDSKTQVATSTEASSP
PPTAEVTSMPTSTPGERSTPLTSMPVRHTPVASSEASTLSTSPVDTSTPVTTSAETSSSP
TTAEGTSLPTSTTSEGSTLLTSIPVSTTLVTSPEASTLLTTPVDTKGPVVTSNEVSSSPT
PAEGTSMPTSTYSEGRTPLTSIPVNTTLVASSAISILSTTPVDNSTPVTTSTEACSSPTT
SEGTSMPNSNPSEGTTPLTS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9VR49	0.048	0.050	8.278E-3	1286	0.215	0.234	Q9VR49.pdb.gz	Q9VR49_DROME Salivary gland secretion 1 OS=Drosophila melanogaster OX=7227 GN=Sgs1 PE=4 SV=4
2	AFDB:Q9C105	0.026	0.029	7.520E-2	1236	0.066	0.074	Q9C105.pdb.gz	YKT4_SCHPO Chitinase-like protein PB1E7.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAPB1E7.04c PE=3 SV=1
3	AFDB:Q9HDY9	0.075	0.089	1.636	1082	0.122	0.158	Q9HDY9.pdb.gz	MAM3_SCHPO M cell-type agglutination protein mam3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mam3 PE=3 SV=2
4	AFDB:G8BJ59	0.042	0.048	1.794	1153	0.086	0.105	G8BJ59.pdb.gz	G8BJ59_CANPC Agglutinin-like protein N-terminal domain-containing protein OS=Candida parapsilosis (strain CDC 317 / ATCC MYA-4646) OX=578454 GN=ALS11 PE=3 SV=1
5	AFDB:Q57V68	0.042	0.052	3.114	992	0.052	0.074	Q57V68.pdb.gz	Q57V68_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.3K10.170 PE=4 SV=1
6	AFDB:Q92953	0.030	0.041	7.810	911	0.038	0.058	Q92953.pdb.gz	KCNB2_HUMAN Potassium voltage-gated channel subfamily B member 2 OS=Homo sapiens OX=9606 GN=KCNB2 PE=1 SV=2
7	AFDB:Q9M9F0	0.025	0.084	8.178	311	0.034	0.151	Q9M9F0.pdb.gz	VQ9_ARATH VQ motif-containing protein 9 OS=Arabidopsis thaliana OX=3702 GN=VQ9 PE=1 SV=1
8	AFDB:F1QGX8	0.022	0.044	8.562	588	0.034	0.080	F1QGX8.pdb.gz
9	AFDB:Q23647	0.024	0.037	8.562	782	0.039	0.069	Q23647.pdb.gz	HPO40_CAEEL Hypersensitive to pore-forming toxin protein 40 OS=Caenorhabditis elegans OX=6239 GN=hpo-40 PE=4 SV=2
10	AFDB:Q7T024	0.035	0.038	8.562	1224	0.029	0.033	Q7T024.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q685J3	0.0	1007	4493	0.609	0.190	MUC17_HUMAN Mucin-17 OS=Homo sapiens OX=9606 GN=MUC17 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000302716

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000485028	0.983	Mucin-13
2	9606.ENSP00000416753	0.980	Mucin-15
3	9606.ENSP00000406861	0.975	Mucin-6
4	9606.ENSP00000381008	0.974	Mucin-16
5	9606.ENSP00000414350	0.974	Mucin-20
6	9606.ENSP00000407422	0.972	Mucin-7
7	9606.ENSP00000436812	0.971	Mucin-5B
8	9606.ENSP00000485659	0.969	Mucin-5AC
9	9606.ENSP00000365473	0.967	Mucin-21
10	9606.ENSP00000484824	0.963	Mucin-1
11	9606.ENSP00000394485	0.950	Na(+)/H(+) exchange regulatory cofactor NHE-RF3
12	9606.ENSP00000368771	0.942	Mucin-3A
13	9606.ENSP00000441929	0.942	Mucin-12
14	9606.ENSP00000417498	0.939	Mucin-4
15	9606.ENSP00000321874	0.931	N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 3
16	9606.ENSP00000379377	0.927	Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3
17	9606.ENSP00000484640	0.926	Acetylgalactosaminyl-O-glycosyl-glycoprotein beta-1,3-N-acetylglucosaminyltransferase
18	9606.ENSP00000389176	0.918	Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1
19	9606.ENSP00000364150	0.916	Polypeptide N-acetylgalactosaminyltransferase 12
20	9606.ENSP00000436604	0.910	Polypeptide N-acetylgalactosaminyltransferase 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003674	1.000	molecular_function
GO:0005201	0.993	extracellular matrix structural constituent
GO:0030165	0.993	PDZ domain binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0042592	0.752	homeostatic process
GO:0019725	0.732	cellular homeostasis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0005796	0.999	Golgi lumen
GO:0098552	0.973	side of membrane
GO:0009986	0.968	cell surface
GO:0098590	0.967	plasma membrane region
GO:0045177	0.965	apical part of cell
GO:0062023	0.949	collagen-containing extracellular matrix
GO:0016324	0.947	apical plasma membrane
GO:0009897	0.942	external side of plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]