StarFunc result for job id Q68CK6

User Input

>input (577 residues)
MHWLRKVQGLCTLWGTQMSSRTLYINSRQLVSLQWGHQEVPAKFNFASDVLDHWADMEKA
GKRLPSPALWWVNGKGKELMWNFRELSENSQQAANILSGACGLQRGDRVAVMLPRVPEWW
LVILGCIRAGLIFMPGTIQMKSTDILYRLQMSKAKAIVAGDEVIQEVDTVASECPSLRIK
LLVSEKSCDGWLNFKKLLNEASTTHHCVETGSQEASAIYFTSGTSGLPKMAEHSYSSLGL
KAKMDAGWTGLQASDIMWTISDTGWILNILGSLLESWTLGACTFVHLLPKFDPLVILKTL
SSYPIKSMMGAPIVYRMLLQQDLSSYKFPHLQNCLAGGESLLPETLENWRAQTGLDIREF
YGQTETGLTCMVSKTMKIKPGYMGTAASCYDVQVIDDKGNVLPPGTEGDIGIRVKPIRPI
GIFSGYVENPDKTAANIRGDFWLLGDRGIKDEDGYFQFMGRADDIINSSGYRIGPSEVEN
ALMKHPAVVETAVISSPDPVRGEVVKAFVILASQFLSHDPEQLTKELQQHVKSVTAPYKY
PRKIEFVLNLPKTVTGKIQRTKLRDKEWKMSGKARAQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:3b7wA	0.924	0.993	0.000	537	0.901	0.968	3b7wA.pdb.gz	Structural snapshots for the conformation-dependent catalysis by human medium-chain acyl-coenzyme A synthetase ACSM2A.
2	AFDB:Q08AH3	0.987	0.987	0.000	577	0.972	0.972	Q08AH3.pdb.gz	ACS2A_HUMAN Acyl-coenzyme A synthetase ACSM2A, mitochondrial OS=Homo sapiens OX=9606 GN=ACSM2A PE=1 SV=2
3	AFDB:Q8K0L3	0.956	0.959	0.000	575	0.752	0.755	Q8K0L3.pdb.gz	ACSM2_MOUSE Acyl-coenzyme A synthetase ACSM2, mitochondrial OS=Mus musculus OX=10090 GN=Acsm2 PE=1 SV=1
4	AFDB:Q3UNX5	0.913	0.908	9.621E-86	580	0.530	0.528	Q3UNX5.pdb.gz	ACSM3_MOUSE Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Mus musculus OX=10090 GN=Acsm3 PE=1 SV=2
5	AFDB:Q7TN78	0.748	0.744	2.129E-84	580	0.570	0.567	Q7TN78.pdb.gz	ACSM4_RAT Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Rattus norvegicus OX=10116 GN=Acsm4 PE=1 SV=1
6	AFDB:Q91VA0	0.897	0.903	5.595E-83	573	0.542	0.546	Q91VA0.pdb.gz	ACSM1_MOUSE Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Mus musculus OX=10090 GN=Acsm1 PE=1 SV=1
7	AFDB:Q08AH1	0.903	0.903	7.893E-83	577	0.542	0.542	Q08AH1.pdb.gz	ACSM1_HUMAN Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Homo sapiens OX=9606 GN=ACSM1 PE=1 SV=1
8	AFDB:Q9BEA2	0.736	0.736	1.571E-82	577	0.568	0.568	Q9BEA2.pdb.gz	ACSM1_BOVIN Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Bos taurus OX=9913 GN=ACSM1 PE=1 SV=2
9	AFDB:Q53FZ2	0.746	0.735	6.475E-80	586	0.537	0.529	Q53FZ2.pdb.gz	ACSM3_HUMAN Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Homo sapiens OX=9606 GN=ACSM3 PE=1 SV=2
10	AFDB:Q729U8	0.715	0.747	2.091E-62	551	0.360	0.377	Q729U8.pdb.gz	Q729U8_DESVH AMP-binding protein OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=DVU_2250 PE=1 SV=1
11	AFDB:A4YDT1	0.688	0.703	1.090E-53	564	0.305	0.312	A4YDT1.pdb.gz	HBCL1_METS5 4-hydroxybutyrate--CoA ligase 1 OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348 / JCM 9185 / NBRC 15509 / TH2) OX=399549 GN=Msed_0406 PE=1 SV=1
12	PDB:2p20A	0.817	0.739	5.138E-44	641	0.231	0.207	2p20A.pdb.gz	Biochemical and Crystallographic Analysis of Substrate Binding and Conformational Changes in Acetyl-CoA Synthetase.
13	PDB:1ry2A	0.672	0.632	2.376E-41	615	0.231	0.216	1ry2A.pdb.gz	Crystal structure of yeast acetyl-coenzyme A synthetase in complex with AMP
14	PDB:5bsmA	0.654	0.709	2.376E-41	530	0.227	0.247	5bsmA.pdb.gz	Structural Basis for Specificity and Flexibility in a Plant 4-Coumarate:CoA Ligase.
15	PDB:6q2mA	0.663	0.700	1.183E-40	544	0.215	0.228	6q2mA.pdb.gz	Mutagenesis and Structural Studies Reveal the Basis for the Activity and Stability Properties That Distinguish thePhotinusLuciferasesscintillansandpyralis.
16	PDB:1ultA	0.655	0.706	5.256E-40	533	0.201	0.218	1ultA.pdb.gz
17	PDB:5ie2A	0.628	0.709	7.853E-40	506	0.213	0.243	5ie2A.pdb.gz	Crystal Structures of Arabidopsis thaliana Oxalyl-CoA Synthetase Essential for Oxalate Degradation
18	PDB:3r44A	0.634	0.723	2.619E-39	502	0.194	0.223	3r44A.pdb.gz	The Mycobacterium tuberculosis Very-Long-Chain Fatty Acyl-CoA Synthetase: Structural Basis for Housing Lipid Substrates Longer than the Enzyme.
19	PDB:3rg2C	0.803	0.758	1.098E-38	613	0.192	0.181	3rg2C.pdb.gz	Structural and Functional Investigation of the Intermolecular Interaction between NRPS Adenylation and Carrier Protein Domains.
20	PDB:7kydA	0.641	0.689	7.225E-37	534	0.218	0.236	7kydA.pdb.gz	FruitFire: a luciferase based on a fruit fly metabolic enzyme.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q08AH1	0.0	675	577	0.555	0.555	ACSM1_HUMAN Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Homo sapiens OX=9606 GN=ACSM1 PE=1 SV=1
2	Q08AH3	0.0	1169	577	0.972	0.972	ACS2A_HUMAN Acyl-coenzyme A synthetase ACSM2A, mitochondrial OS=Homo sapiens OX=9606 GN=ACSM2A PE=1 SV=2
3	Q3UNX5	0.0	650	580	0.518	0.516	ACSM3_MOUSE Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Mus musculus OX=10090 GN=Acsm3 PE=1 SV=2
4	Q53FZ2	0.0	657	586	0.536	0.527	ACSM3_HUMAN Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Homo sapiens OX=9606 GN=ACSM3 PE=1 SV=2
5	Q68CK6	0.0	1197	577	1.000	1.000	ACS2B_HUMAN Acyl-coenzyme A synthetase ACSM2B, mitochondrial OS=Homo sapiens OX=9606 GN=ACSM2B PE=1 SV=2
6	Q7TN78	0.0	684	580	0.558	0.555	ACSM4_RAT Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Rattus norvegicus OX=10116 GN=Acsm4 PE=1 SV=1
7	Q80W40	0.0	684	580	0.567	0.564	ACSM4_MOUSE Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Mus musculus OX=10090 GN=Acsm4 PE=2 SV=1
8	Q8K0L3	0.0	931	575	0.754	0.757	ACSM2_MOUSE Acyl-coenzyme A synthetase ACSM2, mitochondrial OS=Mus musculus OX=10090 GN=Acsm2 PE=1 SV=1
9	Q91VA0	0.0	660	573	0.546	0.550	ACSM1_MOUSE Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Mus musculus OX=10090 GN=Acsm1 PE=1 SV=1
10	Q9BEA2	0.0	696	577	0.568	0.568	ACSM1_BOVIN Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Bos taurus OX=9913 GN=ACSM1 PE=1 SV=2
11	Q729U8	2.50e-124	379	551	0.359	0.376	Q729U8_DESVH AMP-binding protein OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=DVU_2250 PE=1 SV=1
12	A4YDT1	1.33e-86	281	564	0.298	0.305	HBCL1_METS5 4-hydroxybutyrate--CoA ligase 1 OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348 / JCM 9185 / NBRC 15509 / TH2) OX=399549 GN=Msed_0406 PE=1 SV=1
13	Q726Y7	5.07e-50	185	661	0.260	0.227	Q726Y7_DESVH Acetyl-coenzyme A synthetase OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=acsA PE=1 SV=1
14	P27550	7.51e-44	167	652	0.253	0.224	ACSA_ECOLI Acetyl-coenzyme A synthetase OS=Escherichia coli (strain K12) OX=83333 GN=acs PE=1 SV=2
15	Q99NB1	4.17e-43	166	682	0.262	0.221	ACS2L_MOUSE Acetyl-coenzyme A synthetase 2-like, mitochondrial OS=Mus musculus OX=10090 GN=Acss1 PE=1 SV=1
16	P69451	9.14e-43	163	561	0.237	0.244	LCFA_ECOLI Long-chain-fatty-acid--CoA ligase OS=Escherichia coli (strain K12) OX=83333 GN=fadD PE=1 SV=1
17	D3ZZN3	5.24e-42	162	682	0.260	0.220	D3ZZN3_RAT Acetyl-coenzyme A synthetase OS=Rattus norvegicus OX=10116 GN=Acss1 PE=3 SV=1
18	P38135	3.11e-41	159	566	0.267	0.272	FADK_ECOLI Medium-chain fatty-acid--CoA ligase OS=Escherichia coli (strain K12) OX=83333 GN=fadK PE=1 SV=4
19	Q9H6R3	3.40e-41	160	686	0.241	0.203	ACSS3_HUMAN Acyl-CoA synthetase short-chain family member 3, mitochondrial OS=Homo sapiens OX=9606 GN=ACSS3 PE=1 SV=1
20	A0A0B4J1R2	3.54e-41	160	685	0.241	0.203	A0A0B4J1R2_HUMAN propionate--CoA ligase OS=Homo sapiens OX=9606 GN=ACSS3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00501 AMP-binding	1.2e-62	223.6	AMP-binding enzyme
2	PF13193 AMP-binding_C	9.3e-18	76.3	AMP-binding enzyme C-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000327453

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000242592	0.926	Short-chain specific acyl-CoA dehydrogenase, mitochondrial
2	9606.ENSP00000263174	0.642	Palmdelphin
3	9606.ENSP00000295802	0.588	All-trans-retinol 13,14-reductase
4	9606.ENSP00000426290	0.547	Muscular LMNA-interacting protein
5	9606.ENSP00000372804	0.511	mRNA cap guanine-N7 methyltransferase
6	9606.ENSP00000356723	0.507	Dimethylaniline monooxygenase [N-oxide-forming] 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016878	1.000	acid-thiol ligase activity
GO:0016405	1.000	CoA-ligase activity
GO:0015645	0.853	fatty acid ligase activity
GO:0005488	0.834	binding
GO:0005515	0.805	protein binding
GO:0004467	0.564	long-chain fatty acid-CoA ligase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044237	0.986	cellular metabolic process
GO:0071704	0.977	organic substance metabolic process
GO:0044238	0.974	primary metabolic process
GO:0044281	0.970	small molecule metabolic process
GO:0006805	0.900	xenobiotic metabolic process
GO:0006629	0.768	lipid metabolic process
GO:0006807	0.726	nitrogen compound metabolic process
GO:0006082	0.558	organic acid metabolic process
GO:0019752	0.553	carboxylic acid metabolic process
GO:1901564	0.469	organonitrogen compound metabolic process
GO:0032787	0.445	monocarboxylic acid metabolic process
GO:1901360	0.431	organic cyclic compound metabolic process
GO:0034641	0.431	cellular nitrogen compound metabolic process
GO:0006631	0.425	fatty acid metabolic process
GO:0009150	0.416	purine ribonucleotide metabolic process
GO:0006790	0.403	sulfur compound metabolic process
GO:0043603	0.346	amide metabolic process
GO:0035383	0.330	thioester metabolic process
GO:0033875	0.330	ribonucleoside bisphosphate metabolic process
GO:0034032	0.330	purine nucleoside bisphosphate metabolic process
GO:0006637	0.318	acyl-CoA metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0070013	0.998	intracellular organelle lumen
GO:0005759	0.954	mitochondrial matrix

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:6.2.1.-	1.000	Acid--thiol ligases.
RHEA:15421	0.564	a long-chain fatty acid + ATP + CoA = a long-chain fatty acyl-CoA + AMP + diphosphate
EC:6.2.1.3	0.564	long-chain-fatty-acid--CoA ligase.

[back to server]