StarFunc result for job id Q68CP9

User Input

>input (1835 residues)
MANSTGKAPPDERRKGLAFLDELRQFHHSRGSPFKKIPAVGGKELDLHGLYTRVTTLGGF
AKVSEKNQWGEIVEEFNFPRSCSNAAFALKQYYLRYLEKYEKVHHFGEDDDEVPPGNPKP
QLPIGAIPSSYNYQQHSVSDYLRQSYGLSMDFNSPNDYNKLVLSLLSGLPNEVDFAINVC
TLLSNESKHVMQLEKDPKIITLLLANAGVFDDTLGSFSTVFGEEWKEKTDRDFVKFWKDI
VDDNEVRDLISDRNKSHEGTSGEWIWESLFHPPRKLGINDIEGQRVLQIAVILRNLSFEE
GNVKLLAANRTCLRFLLLSAHSHFISLRQLGLDTLGNIAAELLLDPVDFKTTHLMFHTVT
KCLMSRDRFLKMRGMEILGNLCKAEDNGVLICEYVDQDSYREIICHLTLPDVLLVISTLE
VLYMLTEMGDVACTKIAKVEKSIDMLVCLVSMDIQMFGPDALAAVKLIEHPSSSHQMLSE
IRPQAIEQVQTQTHVASAPASRAVVAQHVAPPPGIVEIDSEKFACQWLNAHFEVNPDCSV
SRAEMYSEYLSTCSKLARGGILTSTGFYKCLRTVFPNHTVKRVEDSSSNGQAHIHVVGVK
RRAIPLPIQMYYQQQPVSTSVVRVDSVPDVSPAPSPAGIPHGSQTIGNHFQRTPVANQSS
NLTATQMSFPVQGVHTVAQTVSRIPQNPSPHTHQQQNAPVTVIQSKAPIPCEVVKATVIQ
NSIPQTGVPVSIAVGGGPPQSSVVQNHSTGPQPVTVVNSQTLLHHPSVIPQQSPLHTVVP
GQIPSGTPVTVIQQAVPQSHMFGRVQNIPACTSTVSQGQQLITTSPQPVQTSSQQTSAGS
QSQDTVIIAPPQYVTTSASNIVSATSVQNFQVATGQMVTIAGVPSPQASRVGFQNIAPKP
LPSQQVSSTVVQQPIQQPQQPTQQSVVIVSQPAQQGQTYAPAIHQIVLANPAALPAGQTV
QLTGQPNITPSSSPSPVPATNNQVPTAMSSSSTPQSQGPPPTVSQMLSVKRQQQQQHSPA
PPPQQVQVQVQQPQQVQMQVQPQQSNAGVGQPASGESSLIKQLLLPKRGPSTPGGKLILP
APQIPPPNNARAPSPQVVYQVASNQAAGFGVQGQTPAQQLLVGQQNVQLVPSAMPPSGGV
QTVPISNLQILPGPLISNSPATIFQGTSGNQVTITVVPNTSFAPATVSQGNATQLIAPAG
ITMSGTQTGVGLPVQTLPATQASPAGQSSCTTATPPFKGDKIICQKEEEAKEATGLHVHE
RKIEVMENPSCRRGATNTSNGDTKENEMHVGSLLNGRKYSDSSLPPSNSGKIQSETNQCS
LISNGPSLELGENGASGKQNSEQIDMQDIKSDLRKPLVNGICDFDKGDGSHLSKNIPNHK
TSNHVGNGEISPMEPQGTLDITQQDTAKGDQLERISNGPVLTLGGSSVSSIQEASNAATQ
QFSGTDLLNGPLASSLNSDVPQQRPSVVVSPHSTTSVIQGHQIIAVPDSGSKVSHSPALS
SDVRSTNGTAECKTVKRPAEDTDRETVAGIPNKVGVRIVTISDPNNAGCSATMVAVPAGA
DPSTVAKVAIESAVQQKQQHPPTYVQNVVPQNTPMPPSPAVQVQGQPNSSQPSPFSGSSQ
PGDPMRKPGQNFMCLWQSCKKWFQTPSQVFYHAATEHGGKDVYPGQCLWEGCEPFQRQRF
SFITHLQDKHCSKDALLAGLKQDEPGQAGSQKSSTKQPTVGGTSSTPRAQKAIVNHPSAA
LMALRRGSRNLVFRDFTDEKEGPITKHIRLTAALILKNIGKYSECGRRLLKRHENNLSVL
AISNMEASSTLAKCLYELNFTVQSKEQEKDSEMLQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q68CP9	1.000	1.000	0.000	1835	1.000	1.000	Q68CP9.pdb.gz	ARID2_HUMAN AT-rich interactive domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ARID2 PE=1 SV=2
2	AFDB:A1Z6M0	0.223	0.240	4.684E-45	1688	0.248	0.270	A1Z6M0.pdb.gz	A1Z6M0_DROME Brahma associated protein 170kD OS=Drosophila melanogaster OX=7227 GN=Bap170 PE=1 SV=1
3	AFDB:A0A0G2JZW4	0.096	0.081	1.404E-7	2308	0.158	0.126	A0A0G2JZW4.pdb.gz	A0A0G2JZW4_RAT APC regulator of WNT signaling pathway 2 OS=Rattus norvegicus OX=10116 GN=Apc2 PE=3 SV=2
4	AFDB:Q9VAS9	0.084	0.071	5.137E-7	2417	0.156	0.119	Q9VAS9.pdb.gz	Q9VAS9_DROME APC-like, isoform A OS=Drosophila melanogaster OX=7227 GN=Apc PE=3 SV=1
5	PDB:6lthL	0.120	0.427	2.165E-6	466	0.040	0.159	6lthL.pdb.gz	Structure of nucleosome-bound human BAF complex.
6	AFDB:O95996	0.090	0.078	4.273E-6	2303	0.160	0.127	O95996.pdb.gz	APCL_HUMAN Adenomatous polyposis coli protein 2 OS=Homo sapiens OX=9606 GN=APC2 PE=1 SV=1
7	PDB:6v8oN	0.113	0.441	4.715E-6	412	0.034	0.153	6v8oN.pdb.gz	Architecture of the chromatin remodeler RSC and insights into its nucleosome engagement.
8	PDB:7c4jI	0.111	0.327	2.545E-5	524	0.037	0.130	7c4jI.pdb.gz
9	AFDB:E1C2U2	0.072	0.060	6.165E-4	2326	0.129	0.102	E1C2U2.pdb.gz	RIF1_CHICK Telomere-associated protein RIF1 OS=Gallus gallus OX=9031 GN=RIF1 PE=3 SV=3
10	AFDB:Q1LVF3	0.071	0.090	8.344E-4	1180	0.094	0.147	Q1LVF3.pdb.gz	SMG7_DANRE Nonsense-mediated mRNA decay factor SMG7 OS=Danio rerio OX=7955 GN=smg7 PE=2 SV=2
11	PDB:6kbnC	0.084	0.283	1.143E-3	504	0.030	0.109	6kbnC.pdb.gz	Quaternary structures of Vac8 differentially regulate the Cvt and PMN pathways.
12	PDB:3gniA	0.089	0.322	2.005E-3	335	0.024	0.131	3gniA.pdb.gz	ATP and MO25alpha regulate the conformational state of the STRADalpha pseudokinase and activation of the LKB1 tumour suppressor
13	AFDB:Q21227	0.092	0.129	2.681E-3	1188	0.086	0.133	Q21227.pdb.gz	APR1_CAEEL Adenomatous polyposis coli protein-related protein 1 OS=Caenorhabditis elegans OX=6239 GN=apr-1 PE=1 SV=2
14	AFDB:Q5UIP0	0.088	0.070	2.800E-3	2472	0.127	0.094	Q5UIP0.pdb.gz	RIF1_HUMAN Telomere-associated protein RIF1 OS=Homo sapiens OX=9606 GN=RIF1 PE=1 SV=2
15	PDB:5tbkA	0.086	0.333	4.366E-3	417	0.026	0.115	5tbkA.pdb.gz
16	AFDB:Q6PR54	0.088	0.071	5.591E-3	2419	0.119	0.090	Q6PR54.pdb.gz	RIF1_MOUSE Telomere-associated protein RIF1 OS=Mus musculus OX=10090 GN=Rif1 PE=1 SV=2
17	PDB:3zhpA	0.087	0.335	9.105E-3	315	0.025	0.146	3zhpA.pdb.gz
18	PDB:4tnmA	0.091	0.322	9.105E-3	407	0.024	0.108	4tnmA.pdb.gz
19	PDB:6xu2A	0.092	0.144	9.507E-3	1091	0.036	0.060	6xu2A.pdb.gz	X-ray Structure of the Human Karyopherin RanBP5, an Essential Factor for Influenza Polymerase Nuclear Trafficking.
20	PDB:2z6gA	0.101	0.293	1.037E-2	550	0.023	0.078	2z6gA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9Q7E2	0.0	3324	1828	0.920	0.924	ARID2_MOUSE AT-rich interactive domain-containing protein 2 OS=Mus musculus OX=10090 GN=Arid2 PE=1 SV=1
2	F8W108	0.0	2905	1451	0.790	0.999	F8W108_HUMAN AT-rich interaction domain 2 (Fragment) OS=Homo sapiens OX=9606 GN=ARID2 PE=1 SV=2
3	F8WCU9	0.0	3593	1762	0.960	0.999	F8WCU9_HUMAN AT-rich interaction domain 2 (Fragment) OS=Homo sapiens OX=9606 GN=ARID2 PE=1 SV=2
4	Q68CP9	0.0	3753	1835	1.000	1.000	ARID2_HUMAN AT-rich interactive domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ARID2 PE=1 SV=2
5	A1Z6M0	4.86e-75	280	1688	0.091	0.099	A1Z6M0_DROME Brahma associated protein 170kD OS=Drosophila melanogaster OX=7227 GN=Bap170 PE=1 SV=1
6	Q7KMJ0	5.22e-26	119	1189	0.039	0.060	Q7KMJ0_DROME BcDNA.GH12174 OS=Drosophila melanogaster OX=7227 GN=Bap170 PE=2 SV=1
7	Q9MAT6	1.24e-15	84.0	448	0.019	0.076	HMG15_ARATH High mobility group B protein 15 OS=Arabidopsis thaliana OX=3702 GN=HMGB15 PE=2 SV=1
8	Q9LG02	2.83e-14	78.6	337	0.021	0.113	HMG11_ARATH Putative high mobility group B protein 11 OS=Arabidopsis thaliana OX=3702 GN=HMGB11 PE=1 SV=2
9	Q9SGS2	3.38e-14	78.2	338	0.022	0.118	HMGB9_ARATH High mobility group B protein 9 OS=Arabidopsis thaliana OX=3702 GN=HMGB9 PE=1 SV=1
10	Q62431	3.58e-14	80.1	601	0.021	0.065	ARI3A_MOUSE AT-rich interactive domain-containing protein 3A OS=Mus musculus OX=10090 GN=Arid3a PE=1 SV=1
11	Q8IVW6	6.95e-14	79.3	561	0.021	0.068	ARI3B_HUMAN AT-rich interactive domain-containing protein 3B OS=Homo sapiens OX=9606 GN=ARID3B PE=1 SV=2
12	Q9Z1N7	7.65e-14	79.0	568	0.021	0.067	ARI3B_MOUSE AT-rich interactive domain-containing protein 3B OS=Mus musculus OX=10090 GN=Arid3b PE=1 SV=1
13	Q9LTT3	8.17e-14	77.0	319	0.020	0.113	HMG10_ARATH High mobility group B protein 10 OS=Arabidopsis thaliana OX=3702 GN=HMGB10 PE=1 SV=1
14	Q99856	8.91e-14	79.0	593	0.021	0.066	ARI3A_HUMAN AT-rich interactive domain-containing protein 3A OS=Homo sapiens OX=9606 GN=ARID3A PE=1 SV=2
15	Q24573	5.72e-13	76.6	911	0.020	0.040	DRI_DROME Protein dead ringer OS=Drosophila melanogaster OX=7227 GN=retn PE=1 SV=2
16	A6PWV5	6.41e-13	75.1	409	0.018	0.081	ARI3C_MOUSE AT-rich interactive domain-containing protein 3C OS=Mus musculus OX=10090 GN=Arid3c PE=2 SV=2
17	B7ZP08	6.64e-13	74.7	379	0.018	0.087	B7ZP08_MOUSE AT-rich interactive domain-containing protein 3 OS=Mus musculus OX=10090 GN=Arid3c PE=2 SV=1
18	A6NKF2	8.83e-13	74.7	412	0.018	0.080	ARI3C_HUMAN AT-rich interactive domain-containing protein 3C OS=Homo sapiens OX=9606 GN=ARID3C PE=1 SV=1
19	O02326	1.31e-11	71.6	467	0.019	0.075	CFI1_CAEEL AT-rich interactive domain-containing protein cfi-1 OS=Caenorhabditis elegans OX=6239 GN=cfi-1 PE=1 SV=3
20	H0Y2R3	2.82e-09	64.7	727	0.020	0.051	H0Y2R3_HUMAN AT-rich interaction domain 1B (Fragment) OS=Homo sapiens OX=9606 GN=ARID1B PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01388 ARID	6.1e-21	86.3	ARID/BRIGHT DNA binding domain
2	PF16159 FOXP-CC	66	15.4	FOXP coiled-coil domain
3	PF02257 RFX_DNA_binding	4e-21	86.7	RFX DNA-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000335044

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000378181	0.999	Bromodomain-containing protein 7
2	9606.ENSP00000378307	0.999	Protein polybromo-1
3	9606.ENSP00000395654	0.999	Transcription activator BRG1
4	9606.ENSP00000263121	0.997	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1
5	9606.ENSP00000323967	0.997	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1
6	9606.ENSP00000378414	0.996	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1
7	9606.ENSP00000265773	0.995	Probable global transcription activator SNF2L2
8	9606.ENSP00000267064	0.995	SWI/SNF complex subunit SMARCC2
9	9606.ENSP00000341805	0.993	PHD finger protein 10
10	9606.ENSP00000397552	0.989	Actin-like protein 6A
11	9606.ENSP00000479526	0.989	Zinc finger protein DPF3
12	9606.ENSP00000254480	0.987	SWI/SNF complex subunit SMARCC1
13	9606.ENSP00000160382	0.977	Actin-like protein 6B
14	9606.ENSP00000307208	0.974	Nucleosome-remodeling factor subunit BPTF
15	9606.ENSP00000392617	0.968	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 2
16	9606.ENSP00000262188	0.966	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 3
17	9606.ENSP00000369674	0.914	B-cell CLL/lymphoma 7 protein family member C
18	9606.ENSP00000414516	0.910	Protein SSXT
19	9606.ENSP00000310275	0.907	Barrier-to-autointegration factor
20	9606.ENSP00000349960	0.873	Actin, cytoplasmic 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003677	1.000	DNA binding
GO:0140110	0.713	transcription regulator activity
GO:0043565	0.661	sequence-specific DNA binding
GO:0003690	0.347	double-stranded DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0050789	0.986	regulation of biological process
GO:0071840	0.985	cellular component organization or biogenesis
GO:0050794	0.982	regulation of cellular process
GO:0048518	0.977	positive regulation of biological process
GO:0006338	0.975	chromatin remodeling
GO:0060255	0.971	regulation of macromolecule metabolic process
GO:0019219	0.962	regulation of nucleobase-containing compound metabolic process
GO:0048522	0.933	positive regulation of cellular process
GO:0010604	0.930	positive regulation of macromolecule metabolic process
GO:0051173	0.918	positive regulation of nitrogen compound metabolic process
GO:0031325	0.913	positive regulation of cellular metabolic process
GO:0048519	0.906	negative regulation of biological process
GO:0045935	0.904	positive regulation of nucleobase-containing compound metabolic process
GO:0048583	0.895	regulation of response to stimulus
GO:0048523	0.889	negative regulation of cellular process
GO:0022411	0.733	cellular component disassembly
GO:0010468	0.677	regulation of gene expression
GO:0048584	0.669	positive regulation of response to stimulus
GO:0043933	0.590	protein-containing complex organization
GO:0006355	0.552	regulation of DNA-templated transcription
GO:0071824	0.448	protein-DNA complex subunit organization
GO:0034728	0.439	nucleosome organization
GO:0045893	0.384	positive regulation of DNA-templated transcription
GO:0032501	0.380	multicellular organismal process
GO:0008152	0.378	metabolic process
GO:0048856	0.377	anatomical structure development
GO:0080134	0.358	regulation of response to stress
GO:0042127	0.326	regulation of cell population proliferation
GO:2001020	0.311	regulation of response to DNA damage stimulus
GO:0051052	0.310	regulation of DNA metabolic process
GO:0050896	0.307	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005654	1.000	nucleoplasm
GO:0043232	0.996	intracellular non-membrane-bounded organelle
GO:0032991	0.995	protein-containing complex
GO:0140513	0.959	nuclear protein-containing complex
GO:0000785	0.958	chromatin
GO:1902494	0.956	catalytic complex
GO:0070603	0.922	SWI/SNF superfamily-type complex
GO:0016514	0.754	SWI/SNF complex
GO:0005737	0.725	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]