StarFunc result for job id Q68CQ1

User Input

>input (1323 residues)
MALSPGANLVFHEDPKMTPSPPSCGAPGLGSGTIPQPHPDMAQVPMLNLLPSPGLALVPD
LNDSLSPVSGEASGLVSENTPRPDDSRAIAPASLQITSSCSGEALDLDSKDVSRPDSQGR
LCPASNPILSPSSTEAPRLSSGNHPQSNSEDAFKCLSSKIFKLGQRNSNPSRHELNPFIR
HHSREGLVLGHCISRPSSKALLIPTSNSSLDLDSNPLLNMGSRNTSKLNLNVAPDSHGTL
IPDTNETITLASHNISESVSKGAFSTTWSTSSKETMNVASSGHSRSDLSVTITQASYVTL
IPGSSYGISLHSSTHEPNSTISPPSCMTLILGSNETLSLDSSLLFSDTSTLTLSSQQDDA
KDNSIHTVPLEENLESWSEMASIKVGQFPLGFPISNPAGKDAVTLQGIPEGAFDEVTSCL
VKVPEKTEGGNNMALVENVTTLQKSQDLLEAEGEKKTMIKKIMRQIQEEPLDSLSSSVRK
QAMEILTQLSHTQPTLGMRERSELVNVCVHSVFSLPSVQAMQEKDEAKAETIQALYHQTL
EALQTLLKALFIEDPTPAGLKSILEALGPWMNSGKAHERARAVNTNVSVLNHMLLTLPFF
MPLGFPALGLLLGRLILHIGDPDEEIGCEALDGIIILYTILELQKRARDKEETNKKELYE
SNKHFLGPYNPVSPCQNILRVIEEFGDFLGPQQIKDLLLAALEGLKGSSEAPGKDSREMM
QLASEVMLSSVLEWYRHRALEVIPEIMQGIYMQLSHIQEPRARQVALLPVSLLASSFMTE
VVVALLMCPLPLNSNGAEMWRQLILCKPSCDVRDLLDLLLGSLKEKPVTKEGRASIVPLA
AASGLCELLSVNSCMGRVRRIYPQLLLALLIQVHYHIGLNLPGCVAPPKDTKKGAQPSPF
VPVRWVVKVVKTLLLRMGCSYETTFLEDQGGWELMEQVESHHRGVALLARAMVQYSCQEL
CRILYLLIPLLERGDEKHRITATAFFVELLQMEQVRRIPEEYSLGRMAEGLSHHDPIMKV
LSIRGLVILARRSEKTAKVKALLPSMVKGLKNMDGMLVVEAVHNLKAVFKGRDQKLMDSA
VYVEMLQILLPHFSDAREVVRSSCINLYGKVVQKLRAPRTQAMEEQLVSTLVPLLLTMQE
GNSKVSQKCVKTLLRCSYFMAWELPKRAYSRKPWDNQQQTVAKICKCLVNTHRDSAFIFL
SQSLEYAKNSRASLRKCSVMFIGSLVPCMESIMTEDRLNEVKAALDNLRHDPEASVCIYA
AQVQDHILASCWQNSWLPHGNSWVCYSATTHRWSPSCENLPTSHQRRSWIMQALGSWKMS
LKK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q68CQ1	1.000	1.000	0.000	1323	1.000	1.000	Q68CQ1.pdb.gz	MROH7_HUMAN Maestro heat-like repeat-containing protein family member 7 OS=Homo sapiens OX=9606 GN=MROH7 PE=2 SV=4
2	AFDB:Q14669	0.115	0.087	5.822E-10	1992	0.113	0.075	Q14669.pdb.gz	TRIPC_HUMAN E3 ubiquitin-protein ligase TRIP12 OS=Homo sapiens OX=9606 GN=TRIP12 PE=1 SV=1
3	AFDB:G5E870	0.091	0.070	3.594E-9	2025	0.135	0.088	G5E870.pdb.gz	TRIPC_MOUSE E3 ubiquitin-protein ligase TRIP12 OS=Mus musculus OX=10090 GN=Trip12 PE=1 SV=1
4	PDB:4a0cA	0.130	0.141	2.376E-7	1155	0.091	0.105	4a0cA.pdb.gz	The Molecular Basis of Crl4(Ddb2/Csa) Ubiquitin Ligase Architecture, Targeting, and Activation
5	AFDB:Q86US8	0.065	0.062	2.451E-7	1419	0.121	0.113	Q86US8.pdb.gz	EST1A_HUMAN Telomerase-binding protein EST1A OS=Homo sapiens OX=9606 GN=SMG6 PE=1 SV=2
6	PDB:6ahd1	0.172	0.207	2.956E-7	1048	0.079	0.099	6ahd1.pdb.gz	Structures of the human pre-catalytic spliceosome and its precursor spliceosome.
7	AFDB:F4IKX0	0.103	0.115	3.049E-7	1108	0.107	0.127	F4IKX0.pdb.gz	F4IKX0_ARATH Heat shock protein DnaJ with tetratricopeptide repeat-containing protein OS=Arabidopsis thaliana OX=3702 GN=TPR15 PE=1 SV=1
8	PDB:3w3zA	0.155	0.189	3.297E-7	1013	0.089	0.116	3w3zA.pdb.gz	Structural basis for cell-cycle-dependent nuclear import mediated by the karyopherin Kap121p.
9	PDB:3w3uA	0.148	0.183	3.419E-7	1030	0.107	0.137	3w3uA.pdb.gz
10	PDB:6tc0C	0.155	0.193	7.080E-7	994	0.098	0.130	6tc0C.pdb.gz
11	PDB:6xu2A	0.152	0.178	8.494E-7	1091	0.096	0.116	6xu2A.pdb.gz	X-ray Structure of the Human Karyopherin RanBP5, an Essential Factor for Influenza Polymerase Nuclear Trafficking.
12	PDB:1b3uA	0.141	0.246	1.096E-6	588	0.069	0.155	1b3uA.pdb.gz
13	AFDB:A0A0R4IZ84	0.064	0.058	1.131E-6	1544	0.124	0.106	A0A0R4IZ84.pdb.gz	EST1A_DANRE Telomerase-binding protein EST1A OS=Danio rerio OX=7955 GN=smg6 PE=2 SV=1
14	PDB:3nd2A	0.118	0.162	1.179E-6	861	0.079	0.121	3nd2A.pdb.gz
15	PDB:6n1zA	0.172	0.220	1.414E-6	961	0.090	0.124	6n1zA.pdb.gz
16	PDB:7wttK	0.151	0.179	2.188E-6	1022	0.085	0.110	7wttK.pdb.gz	The nucleoplasmic phase of pre-40S formation prior to nuclear export.
17	AFDB:E5FYH1	0.117	0.102	7.784E-6	1653	0.125	0.100	E5FYH1.pdb.gz	TOPZ1_MOUSE Protein TOPAZ1 OS=Mus musculus OX=10090 GN=Topaz1 PE=2 SV=1
18	AFDB:Q9VCH1	0.089	0.068	6.914E-5	2072	0.137	0.087	Q9VCH1.pdb.gz	Q9VCH1_DROME Eukaryotic translation initiation factor 4G2, isoform A OS=Drosophila melanogaster OX=7227 GN=eIF4G2 PE=1 SV=2
19	AFDB:O43432	0.103	0.091	1.284E-4	1585	0.142	0.119	O43432.pdb.gz	IF4G3_HUMAN Eukaryotic translation initiation factor 4 gamma 3 OS=Homo sapiens OX=9606 GN=EIF4G3 PE=1 SV=2
20	AFDB:Q80XI3	0.111	0.097	3.826E-4	1579	0.135	0.113	Q80XI3.pdb.gz	IF4G3_MOUSE Eukaryotic translation initiation factor 4 gamma 3 OS=Mus musculus OX=10090 GN=Eif4g3 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q68CQ1	0.0	2715	1323	1.000	1.000	MROH7_HUMAN Maestro heat-like repeat-containing protein family member 7 OS=Homo sapiens OX=9606 GN=MROH7 PE=2 SV=4
2	E9PZ22	5.05e-40	163	914	0.154	0.223	E9PZ22_MOUSE Maestro heat-like repeat family member 4 OS=Mus musculus OX=10090 GN=Mroh4 PE=1 SV=1
3	Q14DS2	5.10e-40	163	914	0.154	0.223	Q14DS2_MOUSE 1700016M24Rik protein OS=Mus musculus OX=10090 GN=Mroh4 PE=2 SV=1
4	Q9DA96	5.15e-40	164	983	0.154	0.208	Q9DA96_MOUSE Maestro heat-like repeat family member 5 OS=Mus musculus OX=10090 GN=Mroh4 PE=2 SV=1
5	G3X8W1	5.86e-40	163	983	0.154	0.208	G3X8W1_MOUSE Maestro heat-like repeat family member 4 OS=Mus musculus OX=10090 GN=Mroh4 PE=1 SV=1
6	Q7M6Y6	2.06e-23	110	1581	0.146	0.122	MRO2B_MOUSE Maestro heat-like repeat-containing protein family member 2B OS=Mus musculus OX=10090 GN=Mroh2b PE=1 SV=2
7	Q54F23	4.93e-18	93.2	1647	0.135	0.109	MROH1_DICDI Maestro heat-like repeat-containing protein family member 1 OS=Dictyostelium discoideum OX=44689 GN=mroh1 PE=4 SV=1
8	Q9W350	6.74e-10	66.6	1742	0.107	0.082	Q9W350_DROME C11.1, isoform A OS=Drosophila melanogaster OX=7227 GN=c11.1 PE=1 SV=2
9	A0A5F8MPT5	1.90e-09	63.5	385	0.036	0.122	A0A5F8MPT5_MOUSE Maestro heat-like repeat family member 4 (Fragment) OS=Mus musculus OX=10090 GN=Mroh4 PE=1 SV=1
10	Q9NHY0	1.93e-04	48.5	1407	0.067	0.063	Q9NHY0_DROME C11.1 (Fragment) OS=Drosophila melanogaster OX=7227 GN=c11.1 PE=4 SV=1
11	B7ZVT7	0.20	38.5	2087	0.036	0.023	B7ZVT7_DANRE Coagulation factor V OS=Danio rerio OX=7955 GN=si:bz20i5.3 PE=2 SV=1
12	H0YE65	0.34	35.8	140	0.017	0.164	H0YE65_HUMAN Cyclin dependent kinase like 1 (Fragment) OS=Homo sapiens OX=9606 GN=CDKL1 PE=1 SV=1
13	Q00532	1.4	35.4	358	0.017	0.064	CDKL1_HUMAN Cyclin-dependent kinase-like 1 OS=Homo sapiens OX=9606 GN=CDKL1 PE=1 SV=7
14	Q6XVW8	1.9	35.0	430	0.026	0.081	Q6XVW8_SHIFL protein-secreting ATPase OS=Shigella flexneri OX=623 GN=spa47 PE=1 SV=1
15	Q384K3	6.8	33.5	4152	0.026	0.008	Q384K3_TRYB2 Dynein heavy chain, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.0390 PE=4 SV=1
16	Q02253	7.0	33.5	535	0.017	0.041	MMSA_RAT Methylmalonate-semialdehyde/malonate-semialdehyde dehydrogenase [acylating], mitochondrial OS=Rattus norvegicus OX=10116 GN=Aldh6a1 PE=1 SV=1
17	Q9EQ20	7.1	33.1	535	0.017	0.041	MMSA_MOUSE Methylmalonate-semialdehyde/malonate-semialdehyde dehydrogenase [acylating], mitochondrial OS=Mus musculus OX=10090 GN=Aldh6a1 PE=1 SV=1
18	A0A3F2YNX0	7.2	33.5	2146	0.014	0.009	A0A3F2YNX0_HUMAN Protein transport protein sec16 (Fragment) OS=Homo sapiens OX=9606 GN=SEC16A PE=1 SV=2
19	O15027	7.3	33.5	2357	0.014	0.008	SC16A_HUMAN Protein transport protein Sec16A OS=Homo sapiens OX=9606 GN=SEC16A PE=1 SV=4
20	A6NGQ3	7.5	33.5	8923	0.028	0.004	A6NGQ3_HUMAN non-specific serine/threonine protein kinase OS=Homo sapiens OX=9606 GN=OBSCN PE=1 SV=5

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14352 DUF4402	4.6e+02	12.9	Domain of unknown function (DUF4402)
2	PF18808 Importin_rep_4	4.7	19.0	Importin repeat
3	PF06413 Neugrin	2.4e+02	12.9	Neugrin
4	PF18596 Sld7_C	1.2e+02	14.2	Sld7 C-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000396622

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000360329	0.654	Tetratricopeptide repeat domain containing
2	9606.ENSP00000462106	0.601	Small integral membrane protein 21
3	9606.ENSP00000290158	0.564	Importin subunit beta-1
4	9606.ENSP00000261778	0.520	Transport and golgi organization 6 homolog
5	9606.ENSP00000450444	0.520	HEAT repeat-containing protein 4
6	9606.ENSP00000216036	0.512	Radial spoke head 14 homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.982	cellular process
GO:0065007	0.755	biological regulation
GO:0050789	0.499	regulation of biological process
GO:0050794	0.408	regulation of cellular process
GO:0050896	0.353	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.995	extracellular space
GO:0005737	0.955	cytoplasm
GO:0043229	0.955	intracellular organelle
GO:0043231	0.950	intracellular membrane-bounded organelle
GO:0012505	0.768	endomembrane system
GO:0005634	0.484	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]