StarFunc result for job id Q68CR1

User Input

>input (1132 residues)
MQRRGAGLGWPRQQQQQPPPLAVGPRAAAMVPSGGVPQGLGGRSACALLLLCYLNVVPSL
GRQTSLTTSVIPKAEQSVAYKDFIYFTVFEGNVRNVSEVSVEYLCSQPCVVNLEAVVSSE
FRSSIPVYKKRWKNEKHLHTSRTQIVHVKFPSIMVYRDDYFIRHSISVSAVIVRAWITHK
YSGRDWNVKWEENLLHAVAKNYTLLQTIPPFERPFKDHQVCLEWNMGYIWNLRANRIPQC
PLENDVVALLGFPYASSGENTGIVKKFPRFRNRELEATRRQRMDYPVFTVSLWLYLLHYC
KANLCGILYFVDSNEMYGTPSVFLTEEGYLHIQMHLVKGEDLAVKTKFIIPLKEWFRLDI
SFNGGQIVVTTSIGQDLKSYHNQTISFREDFHYNDTAGYFIIGGSRYVAGIEGFFGPLKY
YRLRSLHPAQIFNPLLEKQLAEQIKLYYERCAEVQEIVSVYASAAKHGGERQEACHLHNS
YLDLQRRYGRPSMCRAFPWEKELKDKHPSLFQALLEMDLLTVPRNQNESVSEIGGKIFEK
AVKRLSSIDGLHQISSIVPFLTDSSCCGYHKASYYLAVFYETGLNVPRDQLQGMLYSLVG
GQGSERLSSMNLGYKHYQGIDNYPLDWELSYAYYSNIATKTPLDQHTLQGDQAYVETIRL
KDDEILKVQTKEDGDVFMWLKHEATRGNAAAQQRLAQMLFWGQQGVAKNPEAAIEWYAKG
ALETEDPALIYDYAIVLFKGQGVKKNRRLALELMKKAASKGLHQAVNGLGWYYHKFKKNY
AKAAKYWLKAEEMGNPDASYNLGVLHLDGIFPGVPGRNQTLAGEYFHKAAQGGHMEGTLW
CSLYYITGNLETFPRDPEKAVVWAKHVAEKNGYLGHVIRKGLNAYLEGSWHEALLYYVLA
AETGIEVSQTNLAHICEERPDLARRYLGVNCVWRYYNFSVFQIDAPSFAYLKMGDLYYYG
HQNQSQDLELSVQMYAQAALDGDSQGFFNLALLIEEGTIIPHHILDFLEIDSTLHSNNIS
ILQELYERCWSHSNEESFSPCSLAWLYLHLRLLWGAILHSALIYFLGTFLLSILIAWTVQ
YFQSVSASDPPPRPSQASPDTATSTASPAVTPAADASDQDQPTVTNNPEPRG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q68CR1	1.000	1.000	0.000	1132	1.000	1.000	Q68CR1.pdb.gz	SE1L3_HUMAN Protein sel-1 homolog 3 OS=Homo sapiens OX=9606 GN=SEL1L3 PE=1 SV=2
2	AFDB:Q9UBV2	0.401	0.560	4.353E-21	794	0.135	0.193	Q9UBV2.pdb.gz	SE1L1_HUMAN Protein sel-1 homolog 1 OS=Homo sapiens OX=9606 GN=SEL1L PE=1 SV=3
3	AFDB:Q9LM25	0.397	0.643	2.525E-20	678	0.140	0.235	Q9LM25.pdb.gz	HRD3A_ARATH ERAD-associated E3 ubiquitin-protein ligase component HRD3A OS=Arabidopsis thaliana OX=3702 GN=HRD3A PE=1 SV=1
4	AFDB:G5EFG0	0.400	0.639	5.421E-19	685	0.115	0.190	G5EFG0.pdb.gz	G5EFG0_CAEEL S5 DRBM domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=sel-1 PE=1 SV=1
5	AFDB:A0A0H2VDN9	0.140	0.291	5.446E-13	490	0.093	0.214	A0A0H2VDN9.pdb.gz	ESIB_ECOL6 Secretory immunoglobulin A-binding protein EsiB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=esiB PE=1 SV=1
6	PDB:4bwrA	0.144	0.312	7.973E-13	467	0.084	0.203	4bwrA.pdb.gz	Crystal Structure of C5321: A Protective Antigen Present in Uropathogenic Escherichia Coli Strains Displaying an Slr Fold.
7	AFDB:P34226	0.147	0.228	1.187E-9	696	0.080	0.131	P34226.pdb.gz	SKT5_YEAST Chitin synthase regulator SKT5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SKT5 PE=1 SV=1
8	AFDB:P77234	0.127	0.385	2.164E-8	325	0.067	0.234	P77234.pdb.gz	YBEQ_ECOLI Sel1-repeat-containing protein YbeQ OS=Escherichia coli (strain K12) OX=83333 GN=ybeQ PE=4 SV=2
9	AFDB:O94486	0.127	0.228	1.142E-6	512	0.063	0.139	O94486.pdb.gz	CHR2_SCHPO Chitin synthase regulatory factor 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=chr2 PE=3 SV=1
10	AFDB:O25001	0.124	0.488	3.589E-6	250	0.040	0.180	O25001.pdb.gz	HCPA_HELPY Beta-lactamase HcpA OS=Helicobacter pylori (strain ATCC 700392 / 26695) OX=85962 GN=hcpA PE=1 SV=1
11	PDB:7mqzA	0.126	0.492	2.696E-5	209	0.043	0.234	7mqzA.pdb.gz
12	PDB:7r5jK0	0.081	0.083	3.739E-5	1086	0.114	0.119	7r5jK0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
13	AFDB:Q9DCV6	0.134	0.283	4.528E-5	510	0.041	0.090	Q9DCV6.pdb.gz	DELE1_MOUSE DAP3-binding cell death enhancer 1 OS=Mus musculus OX=10090 GN=Dele1 PE=2 SV=1
14	PDB:7dkhI	0.117	0.141	1.999E-4	914	0.092	0.114	7dkhI.pdb.gz
15	PDB:4bujB	0.097	0.084	3.402E-4	1367	0.082	0.068	4bujB.pdb.gz
16	PDB:6bq1B	0.110	0.155	3.402E-4	728	0.066	0.103	6bq1B.pdb.gz	Architecture of the human PI4KIII alpha lipid kinase complex.
17	PDB:4horA	0.102	0.212	3.846E-4	482	0.067	0.158	4horA.pdb.gz	Structural basis for viral 5'-PPP-RNA recognition by human IFIT proteins.
18	PDB:7ufgB	0.123	0.118	4.006E-4	1182	0.016	0.015	7ufgB.pdb.gz	Structure of the PAPP-ABP5 complex reveals mechanism of substrate recognition
19	PDB:7ufgA	0.117	0.115	4.529E-4	1151	0.016	0.016	7ufgA.pdb.gz	Structure of the PAPP-ABP5 complex reveals mechanism of substrate recognition
20	PDB:7ntfA	0.128	0.153	4.718E-4	918	0.065	0.081	7ntfA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q68CR1	0.0	2366	1132	1.000	1.000	SE1L3_HUMAN Protein sel-1 homolog 3 OS=Homo sapiens OX=9606 GN=SEL1L3 PE=1 SV=2
2	Q9LM25	3.50e-32	136	678	0.118	0.198	HRD3A_ARATH ERAD-associated E3 ubiquitin-protein ligase component HRD3A OS=Arabidopsis thaliana OX=3702 GN=HRD3A PE=1 SV=1
3	Q9UBV2	8.38e-25	114	794	0.111	0.159	SE1L1_HUMAN Protein sel-1 homolog 1 OS=Homo sapiens OX=9606 GN=SEL1L PE=1 SV=3
4	G5EFG0	1.68e-24	112	685	0.120	0.199	G5EFG0_CAEEL S5 DRBM domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=sel-1 PE=1 SV=1
5	Q9Z2G6	1.54e-23	110	790	0.110	0.158	SE1L1_MOUSE Protein sel-1 homolog 1 OS=Mus musculus OX=10090 GN=Sel1l PE=1 SV=2
6	A0A0H2VDN9	1.08e-10	67.8	490	0.075	0.173	ESIB_ECOL6 Secretory immunoglobulin A-binding protein EsiB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=esiB PE=1 SV=1
7	Q94C27	1.20e-06	54.3	351	0.053	0.171	FB84_ARATH F-box protein At1g70590 OS=Arabidopsis thaliana OX=3702 GN=At1g70590 PE=2 SV=1
8	P77234	7.08e-06	52.0	325	0.049	0.172	YBEQ_ECOLI Sel1-repeat-containing protein YbeQ OS=Escherichia coli (strain K12) OX=83333 GN=ybeQ PE=4 SV=2
9	A0A1D8PK97	1.64e-04	48.1	751	0.056	0.084	A0A1D8PK97_CANAL Chs4p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CHS4 PE=4 SV=1
10	J9VSG5	2.26e-04	47.8	485	0.067	0.157	SKT5_CRYNH Chitin synthase regulator 2 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CSR2 PE=3 SV=1
11	O59732	0.003	43.9	456	0.039	0.096	CHR1_SCHPO Chitin synthase regulatory factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=chr1 PE=1 SV=1
12	Q32PS0	0.004	43.9	616	0.038	0.070	Q32PS0_DANRE Cell division cycle 16 homolog (S. cerevisiae) OS=Danio rerio OX=7955 GN=zgc:123264 PE=1 SV=1
13	P34226	0.009	42.7	696	0.069	0.112	SKT5_YEAST Chitin synthase regulator SKT5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SKT5 PE=1 SV=1
14	O25001	0.023	40.4	250	0.027	0.124	HCPA_HELPY Beta-lactamase HcpA OS=Helicobacter pylori (strain ATCC 700392 / 26695) OX=85962 GN=hcpA PE=1 SV=1
15	Q9SLA6	0.023	40.4	288	0.047	0.184	Q9SLA6_ARATH At2g25570 OS=Arabidopsis thaliana OX=3702 GN=ISE3 PE=1 SV=1
16	Q09897	0.15	38.9	932	0.049	0.060	CHR3_SCHPO Chitin synthase regulatory factor 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=chr3 PE=1 SV=1
17	Q9D4C6	0.36	37.0	346	0.045	0.147	LR2BP_MOUSE LRP2-binding protein OS=Mus musculus OX=10090 GN=Lrp2bp PE=2 SV=1
18	O94486	1.1	35.8	512	0.038	0.084	CHR2_SCHPO Chitin synthase regulatory factor 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=chr2 PE=3 SV=1
19	P39000	1.8	35.0	512	0.040	0.088	SHC1_YEAST Protein SHC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SHC1 PE=2 SV=1
20	P55259	2.4	34.7	537	0.022	0.047	GP2_HUMAN Pancreatic secretory granule membrane major glycoprotein GP2 OS=Homo sapiens OX=9606 GN=GP2 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08238 Sel1	4.1e-19	79.8	Sel1 repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000382767

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000185150	0.641	Endoplasmic reticulum lectin 1
2	9606.ENSP00000318165	0.641	Protein OS-9
3	9606.ENSP00000285928	0.639	Leucine-rich repeat and guanylate kinase domain-containing protein
4	9606.ENSP00000417138	0.634	Phospholipid transfer protein
5	9606.ENSP00000337180	0.602	Antizyme inhibitor 1
6	9606.ENSP00000317165	0.594	Protein KRBA1
7	9606.ENSP00000309836	0.570	Coiled-coil domain-containing protein 13
8	9606.ENSP00000229633	0.553	Histidine triad nucleotide-binding protein 3
9	9606.ENSP00000297477	0.541	Transmembrane protein 184A
10	9606.ENSP00000291574	0.536	Trafficking protein particle complex subunit 10
11	9606.ENSP00000354774	0.533	SPRY domain containing 7
12	9606.ENSP00000366395	0.533	E3 ubiquitin-protein ligase synoviolin
13	9606.ENSP00000308149	0.520	Archaemetzincin-1
14	9606.ENSP00000341874	0.502	Serine/threonine-protein kinase RIO3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.704	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.986	organic substance metabolic process
GO:0009987	0.980	cellular process
GO:0043170	0.976	macromolecule metabolic process
GO:0044238	0.953	primary metabolic process
GO:1901564	0.925	organonitrogen compound metabolic process
GO:0065007	0.907	biological regulation
GO:0050789	0.872	regulation of biological process
GO:0050896	0.829	response to stimulus
GO:0006508	0.806	proteolysis
GO:0050794	0.757	regulation of cellular process
GO:0044237	0.584	cellular metabolic process
GO:0006950	0.577	response to stress
GO:0010498	0.477	proteasomal protein catabolic process
GO:0034976	0.453	response to endoplasmic reticulum stress
GO:0006511	0.452	ubiquitin-dependent protein catabolic process
GO:0048519	0.344	negative regulation of biological process
GO:0036503	0.337	ERAD pathway
GO:0051179	0.308	localization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0005737	0.654	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]