StarFunc result for job id Q68CZ1

User Input

>input (1315 residues)
MSGPTDETAGDLPVKDTGLNLFGMGGLQETSTTRTMKSRQAVSRVSREELEDRFLRLHDE
NILLKQHARKQEDKIKRMATKLIRLVNDKKRYERVGGGPKRLGRDVEMEEMIEQLQEKVH
ELEKQNETLKNRLISAKQQLQTQGYRQTPYNNVQSRINTGRRKANENAGLQECPRKGIKF
QDADVAETPHPMFTKYGNSLLEEARGEIRNLENVIQSQRGQIEELEHLAEILKTQLRRKE
NEIELSLLQLREQQATDQRSNIRDNVEMIKLHKQLVEKSNALSAMEGKFIQLQEKQRTLR
ISHDALMANGDELNMQLKEQRLKCCSLEKQLHSMKFSERRIEELQDRINDLEKERELLKE
NYDKLYDSAFSAAHEEQWKLKEQQLKVQIAQLETALKSDLTDKTEILDRLKTERDQNEKL
VQENRELQLQYLEQKQQLDELKKRIKLYNQENDINADELSEALLLIKAQKEQKNGDLSFL
VKVDSEINKDLERSMRELQATHAETVQELEKTRNMLIMQHKINKDYQMEVEAVTRKMENL
QQDYELKVEQYVHLLDIRAARIHKLEAQLKDIAYGTKQYKFKPEIMPDDSVDEFDETIHL
ERGENLFEIHINKVTFSSEVLQASGDKEPVTFCTYAFYDFELQTTPVVRGLHPEYNFTSQ
YLVHVNDLFLQYIQKNTITLEVHQAYSTEYETIAACQLKFHEILEKSGRIFCTASLIGTK
GDIPNFGTVEYWFRLRVPMDQAIRLYRERAKALGYITSNFKGPEHMQSLSQQAPKTAQLS
STDSTDGNLNELHITIRCCNHLQSRASHLQPHPYVVYKFFDFADHDTAIIPSSNDPQFDD
HMYFPVPMNMDLDRYLKSESLSFYVFDDSDTQENIYIGKVNVPLISLAHDRCISGIFELT
DHQKHPAGTIHVILKWKFAYLPPSGSITTEDLGNFIRSEEPEVVQRLPPASSVSTLVLAP
RPKPRQRLTPVDKKVSFVDIMPHQSDETSPPPEDRKEISPEVEHIPEIEINMLTVPHVPK
VSQEGSVDEVKENTEKMQQGKDDVSLLSEGQLAEQSLASSEDETEITEDLEPEVEEDMSA
SDSDDCIIPGPISKNIKQSLALSPGLGCSSAISAHCNFRLPGSSDFPASASQVDGITGAC
HHTQPSEKIRIEIIALSLNDSQVTMDDTIQRLFVECRFYSLPAEETPVSLPKPKSGQWVY
YNYSNVIYVDKENNKAKRDILKAILQKQEMPNRSLRFTVVSDPPEDEQDLECEDIGVAHV
DLADMFQEGRDLIEQNIDVFDARADGEGIGKLRVTVEALHALQSVYKQYRDDLEA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D3Z8G3	0.300	0.309	0.000	1264	0.814	0.847	D3Z8G3.pdb.gz	D3Z8G3_RAT Rpgrip1-like OS=Rattus norvegicus OX=10116 GN=Rpgrip1l PE=3 SV=2
2	AFDB:E1BJB4	0.285	0.293	0.000	1270	0.875	0.906	E1BJB4.pdb.gz	E1BJB4_BOVIN RPGRIP1 like OS=Bos taurus OX=9913 GN=RPGRIP1L PE=1 SV=3
3	AFDB:G3K006	0.263	0.270	0.000	1258	0.494	0.516	G3K006.pdb.gz
4	AFDB:H3BS47	0.216	0.224	0.000	1253	0.941	0.987	H3BS47.pdb.gz	H3BS47_HUMAN RPGRIP1 like OS=Homo sapiens OX=9606 GN=RPGRIP1L PE=1 SV=1
5	AFDB:Q68CZ1	1.000	1.000	0.000	1315	1.000	1.000	Q68CZ1.pdb.gz	FTM_HUMAN Protein fantom OS=Homo sapiens OX=9606 GN=RPGRIP1L PE=1 SV=2
6	AFDB:E9QHV7	0.138	0.136	3.861E-78	1342	0.315	0.308	E9QHV7.pdb.gz
7	AFDB:Q9FJG3	0.092	0.114	4.612E-10	1049	0.061	0.076	Q9FJG3.pdb.gz	MCT16_ARATH Multiple C2 domain and transmembrane region protein 16 OS=Arabidopsis thaliana OX=3702 GN=MCTP16 PE=2 SV=1
8	AFDB:Q8R361	0.094	0.180	1.797E-9	645	0.049	0.099	Q8R361.pdb.gz	RFIP5_MOUSE Rab11 family-interacting protein 5 OS=Mus musculus OX=10090 GN=Rab11fip5 PE=1 SV=2
9	AFDB:Q6WKZ4	0.088	0.090	2.233E-9	1283	0.040	0.041	Q6WKZ4.pdb.gz	RFIP1_HUMAN Rab11 family-interacting protein 1 OS=Homo sapiens OX=9606 GN=RAB11FIP1 PE=1 SV=3
10	PDB:5iz5B	0.085	0.143	4.222E-9	746	0.025	0.044	5iz5B.pdb.gz
11	AFDB:X2JEA7	0.088	0.257	4.529E-9	420	0.036	0.112	X2JEA7.pdb.gz	X2JEA7_DROME Rab11 interacting protein, isoform C OS=Drosophila melanogaster OX=7227 GN=Rip11 PE=1 SV=1
12	PDB:6kxkD	0.082	0.177	6.888E-9	553	0.033	0.080	6kxkD.pdb.gz	Crystal Structure of an Arabidopsis Copine providing insights into this protein family
13	PDB:5iz5A	0.079	0.134	9.374E-8	757	0.023	0.040	5iz5A.pdb.gz
14	PDB:5ixcA	0.076	0.141	9.205E-7	684	0.024	0.045	5ixcA.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
15	PDB:5izrC	0.077	0.149	1.674E-6	659	0.024	0.047	5izrC.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
16	PDB:5a50A	0.082	0.547	3.786E-6	165	0.020	0.158	5a50A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
17	PDB:3nsjA	0.088	0.204	4.221E-6	530	0.029	0.072	3nsjA.pdb.gz	The structural basis for membrane binding and pore formation by lymphocyte perforin.
18	PDB:5a52A	0.079	0.564	4.706E-6	154	0.018	0.156	5a52A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
19	PDB:1cjyA	0.083	0.166	7.272E-6	633	0.014	0.030	1cjyA.pdb.gz	Crystal structure of human cytosolic phospholipase A2 reveals a novel topology and catalytic mechanism.
20	PDB:4rj9A	0.084	0.594	9.039E-6	161	0.017	0.143	4rj9A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A087WX34	0.0	2597	1269	0.965	1.000	A0A087WX34_HUMAN RPGRIP1 like OS=Homo sapiens OX=9606 GN=RPGRIP1L PE=1 SV=1
2	A0A8I6A999	0.0	2019	1193	0.763	0.841	A0A8I6A999_RAT Rpgrip1-like OS=Rattus norvegicus OX=10116 GN=Rpgrip1l PE=3 SV=1
3	D3Z8G3	0.0	2156	1268	0.814	0.845	D3Z8G3_RAT Rpgrip1-like OS=Rattus norvegicus OX=10116 GN=Rpgrip1l PE=3 SV=2
4	E1BJB4	0.0	2343	1270	0.876	0.907	E1BJB4_BOVIN RPGRIP1 like OS=Bos taurus OX=9913 GN=RPGRIP1L PE=1 SV=3
5	E7F4E7	0.0	1046	1256	0.408	0.428	E7F4E7_DANRE Protein fantom OS=Danio rerio OX=7955 GN=si:ch1073-301i20.1 PE=3 SV=2
6	H3BPF5	0.0	719	354	0.269	1.000	H3BPF5_HUMAN RPGRIP1 like (Fragment) OS=Homo sapiens OX=9606 GN=RPGRIP1L PE=1 SV=1
7	H3BS47	0.0	2523	1253	0.941	0.987	H3BS47_HUMAN RPGRIP1 like OS=Homo sapiens OX=9606 GN=RPGRIP1L PE=1 SV=1
8	H3BV03	0.0	2634	1281	0.974	1.000	H3BV03_HUMAN RPGRIP1 like OS=Homo sapiens OX=9606 GN=RPGRIP1L PE=1 SV=1
9	Q68CZ1	0.0	2721	1315	1.000	1.000	FTM_HUMAN Protein fantom OS=Homo sapiens OX=9606 GN=RPGRIP1L PE=1 SV=2
10	Q8CG73	0.0	2187	1264	0.821	0.854	FTM_MOUSE Protein fantom OS=Mus musculus OX=10090 GN=Rpgrip1l PE=1 SV=2
11	F1PKQ6	4.25e-149	484	1209	0.237	0.257	F1PKQ6_CANLF RPGR-interacting protein 1 OS=Canis lupus familiaris OX=9615 GN=RPGRIP1 PE=2 SV=2
12	Q96KN7	9.75e-146	478	1286	0.258	0.264	RPGR1_HUMAN X-linked retinitis pigmentosa GTPase regulator-interacting protein 1 OS=Homo sapiens OX=9606 GN=RPGRIP1 PE=1 SV=2
13	A0A8I6A160	3.01e-130	436	1327	0.230	0.228	A0A8I6A160_RAT RPGR interacting protein 1 OS=Rattus norvegicus OX=10116 GN=Rpgrip1 PE=3 SV=1
14	Q9EPQ2	1.47e-127	429	1331	0.229	0.226	RPGR1_MOUSE X-linked retinitis pigmentosa GTPase regulator-interacting protein 1 OS=Mus musculus OX=10090 GN=Rpgrip1 PE=1 SV=1
15	A0A8I6APX2	4.45e-43	174	1123	0.068	0.080	A0A8I6APX2_RAT RPGR interacting protein 1 OS=Rattus norvegicus OX=10116 GN=Rpgrip1 PE=4 SV=1
16	Q09459	1.51e-16	88.2	1322	0.071	0.071	FTM_CAEEL Protein fantom OS=Caenorhabditis elegans OX=6239 GN=mks-5 PE=2 SV=4
17	P51957	2.75e-13	77.0	841	0.037	0.058	NEK4_HUMAN Serine/threonine-protein kinase Nek4 OS=Homo sapiens OX=9606 GN=NEK4 PE=1 SV=2
18	E7EX48	5.66e-13	75.9	722	0.037	0.068	E7EX48_HUMAN NIMA related kinase 4 (Fragment) OS=Homo sapiens OX=9606 GN=NEK4 PE=1 SV=1
19	A0A8I6GGU8	1.46e-12	70.9	231	0.029	0.165	A0A8I6GGU8_RAT RPGR interacting protein 1 OS=Rattus norvegicus OX=10116 GN=Rpgrip1 PE=4 SV=1
20	Q4V8G9	2.30e-12	70.9	245	0.030	0.163	Q4V8G9_RAT RPGR interacting protein 1 OS=Rattus norvegicus OX=10116 GN=Rpgrip1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00168 C2	6e-08	44.3	C2 domain
2	PF11618 C2-C2_1	6.4e-65	229.0	First C2 domain of RPGR-interacting protein 1
3	PF14924 DUF4497	23	16.8	Protein of unknown function (DUF4497)
4	PF18111 RPGR1_C	2.3e-61	218.0	Retinitis pigmentosa G-protein regulator interacting C-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000369257

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000367398	0.999	Nephrocystin-4
2	9606.ENSP00000367766	0.993	X-linked retinitis pigmentosa GTPase regulator
3	9606.ENSP00000313169	0.988	Nephrocystin-1
4	9606.ENSP00000448012	0.971	Centrosomal protein of 290 kDa
5	9606.ENSP00000389998	0.960	Meckelin
6	9606.ENSP00000382895	0.951	X-linked retinitis pigmentosa GTPase regulator-interacting protein 1
7	9606.ENSP00000379258	0.948	Transcriptional activator GLI3
8	9606.ENSP00000228682	0.937	Zinc finger protein GLI1
9	9606.ENSP00000403465	0.937	Coiled-coil and C2 domain-containing protein 2A
10	9606.ENSP00000390436	0.935	Zinc finger protein GLI2
11	9606.ENSP00000356774	0.929	Jouberin
12	9606.ENSP00000358918	0.923	Suppressor of fused homolog
13	9606.ENSP00000310129	0.898	26S proteasome non-ATPase regulatory subunit 2
14	9606.ENSP00000258173	0.877	Transmembrane protein 231
15	9606.ENSP00000440638	0.876	Transmembrane protein 216
16	9606.ENSP00000261499	0.865	B9 domain-containing protein 1
17	9606.ENSP00000311505	0.841	IQ calmodulin-binding motif-containing protein 1
18	9606.ENSP00000338766	0.835	Nephrocystin-3
19	9606.ENSP00000304941	0.827	Tectonic-2
20	9606.ENSP00000243578	0.814	B9 domain-containing protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0001664	0.821	G protein-coupled receptor binding
GO:0031870	0.712	thromboxane A2 receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.985	regulation of cellular process
GO:0009987	0.896	cellular process
GO:0048583	0.727	regulation of response to stimulus
GO:0023051	0.657	regulation of signaling
GO:0010646	0.657	regulation of cell communication
GO:0009966	0.654	regulation of signal transduction
GO:0048523	0.616	negative regulation of cellular process
GO:0071840	0.591	cellular component organization or biogenesis
GO:0032501	0.576	multicellular organismal process
GO:0016043	0.552	cellular component organization
GO:0044782	0.500	cilium organization
GO:0008277	0.494	regulation of G protein-coupled receptor signaling pathway
GO:0048856	0.486	anatomical structure development
GO:0007275	0.468	multicellular organism development
GO:0022607	0.420	cellular component assembly
GO:0060271	0.395	cilium assembly
GO:0023057	0.334	negative regulation of signaling
GO:0010648	0.334	negative regulation of cell communication
GO:0009968	0.307	negative regulation of signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.998	cytosol
GO:0005654	0.997	nucleoplasm
GO:0005886	0.996	plasma membrane
GO:0043232	0.987	intracellular non-membrane-bounded organelle
GO:0005929	0.968	cilium
GO:0005815	0.938	microtubule organizing center
GO:0035869	0.748	ciliary transition zone
GO:0036064	0.729	ciliary basal body
GO:0005813	0.558	centrosome
GO:0005930	0.538	axoneme
GO:0030054	0.336	cell junction
GO:0070161	0.324	anchoring junction
GO:0005911	0.313	cell-cell junction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]