StarFunc result for job id Q68CZ2

User Input

>input (1445 residues)
MEEGHGLDLTYITERIIAVSFPAGCSEESYLHNLQEVTRMLKSKHGDNYLVLNLSEKRYD
LTKLNPKIMDVGWPELHAPPLDKMCTICKAQESWLNSNLQHVVVIHCRGGKGRIGVVISS
YMHFTNVSASADQALDRFAMKKFYDDKVSALMQPSQKRYVQFLSGLLSGSVKMNASPLFL
HFVILHGTPNFDTGGVCRPFLKLYQAMQPVYTSGIYNVGPENPSRICIVIEPAQLLKGDV
MVKCYHKKYRSATRDVIFRLQFHTGAVQGYGLVFGKEDLDNASKDDRFPDYGKVELVFSA
TPEKIQGSEHLYNDHGVIVDYNTTDPLIRWDSYENLSADGEVLHTQGPVDGSLYAKVRKK
SSSDPGIPGGPQAIPATNSPDHSDHTLSVSSDSGHSTASARTDKTEERLAPGTRRGLSAQ
EKAELDQLLSGFGLEDPGSSLKEMTDARSKYSGTRHVVPAQVHVNGDAALKDRETDILDD
EMPHHDLHSVDSLGTLSSSEGPQSAHLGPFTCHKSSQNSLLSDGFGSNVGEDPQGTLVPD
LGLGMDGPYERERTFGSREPKQPQPLLRKPSVSAQMQAYGQSSYSTQTWVRQQQMVVAHQ
YSFAPDGEARLVSRCPADNPGLVQAQPRVPLTPTRGTSSRVAVQRGVGSGPHPPDTQQPS
PSKAFKPRFPGDQVVNGAGPELSTGPSPGSPTLDIDQSIEQLNRLILELDPTFEPIPTHM
NALGSQANGSVSPDSVGGGLRASSRLPDTGEGPSRATGRQGSSAEQPLGGRLRKLSLGQY
DNDAGGQLPFSKCAWGKAGVDYAPNLPPFPSPADVKETMTPGYPQDLDIIDGRILSSKES
MCSTPAFPVSPETPYVKTALRHPPFSPPEPPLSSPASQHKGGREPRSCPETLTHAVGMSE
SPIGPKSTMLRADASSTPSFQQAFASSCTISSNGPGQRRESSSSAERQWVESSPKPMVSL
LGSGRPTGSPLSAEFSGTRKDSPVLSCFPPSELQAPFHSHELSLAEPPDSLAPPSSQAFL
GFGTAPVGSGLPPEEDLGALLANSHGASPTPSIPLTATGAADNGFLSHNFLTVAPGHSSH
HSPGLQGQGVTLPGQPPLPEKKRASEGDRSLGSVSPSSSGFSSPHSGSTISIPFPNVLPD
FSKASEAASPLPDSPGDKLVIVKFVQDTSKFWYKADISREQAIAMLKDKEPGSFIVRDSH
SFRGAYGLAMKVATPPPSVLQLNKKAGDLANELVRHFLIECTPKGVRLKGCSNEPYFGSL
TALVCQHSITPLALPCKLLIPERDPLEEIAESSPQTAANSAAELLKQGAACNVWYLNSVE
MESLTGHQAIQKALSITLVQEPPPVSTVVHFKVSAQGITLTDNQRKLFFRRHYPVNSVIF
CALDPQDRKWIKDGPSSKVFGFVARKQGSATDNVCHLFAEHDPEQPASAIVNFVSKVMIG
SPKKV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q04205	0.251	0.211	0.000	1744	0.492	0.408	Q04205.pdb.gz	TENS1_CHICK Tensin-1 OS=Gallus gallus OX=9031 GN=TNS1 PE=1 SV=3
2	AFDB:Q5SSZ5	0.297	0.298	0.000	1440	0.832	0.835	Q5SSZ5.pdb.gz	TENS3_MOUSE Tensin-3 OS=Mus musculus OX=10090 GN=Tns3 PE=1 SV=1
3	AFDB:Q68CZ2	1.000	1.000	0.000	1445	1.000	1.000	Q68CZ2.pdb.gz	TENS3_HUMAN Tensin-3 OS=Homo sapiens OX=9606 GN=TNS3 PE=1 SV=2
4	AFDB:Q9HBL0	0.235	0.197	0.000	1735	0.496	0.413	Q9HBL0.pdb.gz	TENS1_HUMAN Tensin-1 OS=Homo sapiens OX=9606 GN=TNS1 PE=1 SV=3
5	AFDB:E9Q0S6	0.254	0.199	1.034E-103	1888	0.493	0.378	E9Q0S6.pdb.gz	TENS1_MOUSE Tensin-1 OS=Mus musculus OX=10090 GN=Tns1 PE=1 SV=1
6	AFDB:Q63HR2	0.232	0.238	2.077E-94	1409	0.376	0.386	Q63HR2.pdb.gz	TENS2_HUMAN Tensin-2 OS=Homo sapiens OX=9606 GN=TNS2 PE=1 SV=2
7	PDB:7jvxA	0.186	0.798	1.468E-20	314	0.066	0.306	7jvxA.pdb.gz
8	AFDB:Q9VID5	0.061	0.082	9.819E-7	1039	0.102	0.142	Q9VID5.pdb.gz	Q9VID5_DROME Uncharacterized protein, isoform A OS=Drosophila melanogaster OX=7227 GN=Dmel\CG8671 PE=3 SV=2
9	AFDB:Q9W2S5	0.094	0.067	1.496E-6	2139	0.131	0.088	Q9W2S5.pdb.gz	Q9W2S5_DROME X11Lbeta, isoform A OS=Drosophila melanogaster OX=7227 GN=X11Lbeta PE=1 SV=5
10	AFDB:Q8N3D4	0.070	0.067	1.439E-5	1523	0.118	0.112	Q8N3D4.pdb.gz	EH1L1_HUMAN EH domain-binding protein 1-like protein 1 OS=Homo sapiens OX=9606 GN=EHBP1L1 PE=1 SV=2
11	AFDB:P27715	0.063	0.046	3.340E-5	2155	0.116	0.078	P27715.pdb.gz	UNC13_CAEEL Phorbol ester/diacylglycerol-binding protein unc-13 OS=Caenorhabditis elegans OX=6239 GN=unc-13 PE=1 SV=4
12	PDB:5bx1A	0.087	0.645	2.376E-4	153	0.015	0.137	5bx1A.pdb.gz	Crystal Structure of PRL-1 complex with compound analogy 3
13	PDB:1k9aB	0.061	0.192	4.022E-4	441	0.025	0.082	1k9aB.pdb.gz
14	PDB:5xzrA	0.067	0.168	4.239E-4	519	0.034	0.094	5xzrA.pdb.gz	Allosteric Inhibitors of SHP2 with Therapeutic Potential for Cancer Treatment.
15	PDB:4k2rA	0.064	0.156	4.710E-4	551	0.030	0.080	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
16	PDB:2lqnA	0.066	0.279	5.515E-4	303	0.032	0.152	2lqnA.pdb.gz
17	PDB:3afoA	0.056	0.124	5.515E-4	360	0.028	0.111	3afoA.pdb.gz	The structural factor conferring NADH kinase activity on yeast mitochondrial Pos5
18	PDB:1griA	0.062	0.381	6.459E-4	211	0.021	0.147	1griA.pdb.gz
19	PDB:2esbA	0.082	0.572	7.176E-4	162	0.024	0.210	2esbA.pdb.gz
20	PDB:5a50A	0.055	0.317	7.564E-4	165	0.011	0.097	5a50A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A2R8Y4T1	0.0	677	1860	0.263	0.204	A0A2R8Y4T1_HUMAN Tensin 1 OS=Homo sapiens OX=9606 GN=TNS1 PE=1 SV=1
2	A0A494C067	0.0	678	1827	0.263	0.208	A0A494C067_HUMAN Tensin 1 (Fragment) OS=Homo sapiens OX=9606 GN=TNS1 PE=1 SV=1
3	E7ERH1	0.0	662	780	0.249	0.462	E7ERH1_HUMAN Tensin 1 (Fragment) OS=Homo sapiens OX=9606 GN=TNS1 PE=1 SV=1
4	E9PCX8	0.0	2337	1249	0.793	0.918	E9PCX8_HUMAN Tensin 3 OS=Homo sapiens OX=9606 GN=TNS3 PE=1 SV=9
5	E9PF55	0.0	678	1721	0.263	0.221	E9PF55_HUMAN Tensin 1 OS=Homo sapiens OX=9606 GN=TNS1 PE=1 SV=1
6	E9PGF5	0.0	677	1714	0.263	0.222	E9PGF5_HUMAN Tensin 1 OS=Homo sapiens OX=9606 GN=TNS1 PE=1 SV=1
7	E9Q0S6	0.0	664	1888	0.261	0.200	TENS1_MOUSE Tensin-1 OS=Mus musculus OX=10090 GN=Tns1 PE=1 SV=1
8	Q04205	0.0	668	1744	0.267	0.221	TENS1_CHICK Tensin-1 OS=Gallus gallus OX=9031 GN=TNS1 PE=1 SV=3
9	Q5SSZ5	0.0	2398	1440	0.833	0.835	TENS3_MOUSE Tensin-3 OS=Mus musculus OX=10090 GN=Tns3 PE=1 SV=1
10	Q68CZ2	0.0	2958	1445	1.000	1.000	TENS3_HUMAN Tensin-3 OS=Homo sapiens OX=9606 GN=TNS3 PE=1 SV=2
11	Q9HBL0	0.0	678	1839	0.263	0.207	TENS1_HUMAN Tensin-1 OS=Homo sapiens OX=9606 GN=TNS1 PE=1 SV=3
12	H0Y4U1	2.07e-143	462	846	0.162	0.277	H0Y4U1_HUMAN Tensin 1 OS=Homo sapiens OX=9606 GN=TNS1 PE=1 SV=1
13	Q63HR2	1.81e-134	452	1409	0.155	0.159	TENS2_HUMAN Tensin-2 OS=Homo sapiens OX=9606 GN=TNS2 PE=1 SV=2
14	Q8CGB6	4.48e-133	448	1400	0.154	0.159	TENS2_MOUSE Tensin-2 OS=Mus musculus OX=10090 GN=Tns2 PE=1 SV=1
15	F7FBH3	2.68e-130	441	1454	0.153	0.152	F7FBH3_RAT Tensin 2 OS=Rattus norvegicus OX=10116 GN=Tns2 PE=1 SV=1
16	Q8IZW8	6.71e-89	307	715	0.103	0.208	TENS4_HUMAN Tensin-4 OS=Homo sapiens OX=9606 GN=TNS4 PE=1 SV=3
17	H2L045	1.52e-83	303	1354	0.110	0.117	TENSH_CAEEL Tensin homolog OS=Caenorhabditis elegans OX=6239 GN=tns-1 PE=1 SV=2
18	Q9VHC3	2.71e-78	277	720	0.093	0.188	Q9VHC3_DROME Blistery, isoform A OS=Drosophila melanogaster OX=7227 GN=by PE=2 SV=1
19	Q7ZZ56	2.76e-38	150	399	0.074	0.268	Q7ZZ56_DANRE Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN OS=Danio rerio OX=7955 GN=fa11a08 PE=2 SV=1
20	Q6TGR7	8.55e-37	147	431	0.062	0.206	Q6TGR7_DANRE Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN OS=Danio rerio OX=7955 GN=wu:fc52g04 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08416 PTB	3.6e-38	142.0	Phosphotyrosine-binding domain
2	PF10409 PTEN_C2	2.5e-26	103.4	C2 domain of PTEN tumour-suppressor protein
3	PF00017 SH2	4e-06	38.2	SH2 domain
4	PF00102 Y_phosphatase	2.8e+02	12.4	Protein-tyrosine phosphatase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000312143

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000275493	0.895	Epidermal growth factor receptor
2	9606.ENSP00000391669	0.845	Breast cancer anti-estrogen resistance protein 1
3	9606.ENSP00000379350	0.828	Integrin beta-1
4	9606.ENSP00000276297	0.788	Rho GTPase-activating protein 7
5	9606.ENSP00000341189	0.787	Focal adhesion kinase 1
6	9606.ENSP00000313829	0.756	KH domain-containing, RNA-binding, signal transduction-associated protein 1
7	9606.ENSP00000323927	0.748	Plexin domain-containing protein 1
8	9606.ENSP00000317272	0.705	Hepatocyte growth factor receptor
9	9606.ENSP00000269571	0.686	Receptor tyrosine-protein kinase erbB-2
10	9606.ENSP00000357475	0.680	Phospholipid-transporting ATPase ID
11	9606.ENSP00000258888	0.676	Alpha-protein kinase 3
12	9606.ENSP00000040738	0.672	Biorientation of chromosomes in cell division protein 1-like 1
13	9606.ENSP00000299432	0.665	Putative protein MSS51 homolog, mitochondrial
14	9606.ENSP00000379975	0.636	Integrin-linked protein kinase
15	9606.ENSP00000222390	0.631	Hepatocyte growth factor
16	9606.ENSP00000362680	0.550	Proto-oncogene tyrosine-protein kinase Src
17	9606.ENSP00000220003	0.541	Tyrosine-protein kinase CSK
18	9606.ENSP00000472469	0.524	Ribosomal protein S28
19	9606.ENSP00000308117	0.509	Endosialin
20	9606.ENSP00000469468	0.507	U6 snRNA-associated Sm-like protein LSm4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019899	0.399	enzyme binding
GO:0003824	0.397	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0050794	0.988	regulation of cellular process
GO:0048583	0.964	regulation of response to stimulus
GO:0010646	0.957	regulation of cell communication
GO:0032501	0.949	multicellular organismal process
GO:0023051	0.949	regulation of signaling
GO:0048519	0.936	negative regulation of biological process
GO:0009966	0.922	regulation of signal transduction
GO:0048523	0.892	negative regulation of cellular process
GO:0016043	0.886	cellular component organization
GO:0048522	0.869	positive regulation of cellular process
GO:1902531	0.797	regulation of intracellular signal transduction
GO:0032502	0.778	developmental process
GO:0048584	0.767	positive regulation of response to stimulus
GO:0048856	0.748	anatomical structure development
GO:0009967	0.701	positive regulation of signal transduction
GO:1902533	0.675	positive regulation of intracellular signal transduction
GO:0007275	0.656	multicellular organism development
GO:0050790	0.638	regulation of catalytic activity
GO:0044093	0.625	positive regulation of molecular function
GO:0016477	0.480	cell migration
GO:0050896	0.424	response to stimulus
GO:0009968	0.396	negative regulation of signal transduction
GO:0042127	0.382	regulation of cell population proliferation
GO:0008152	0.349	metabolic process
GO:0048731	0.346	system development
GO:0044085	0.334	cellular component biogenesis
GO:0051056	0.324	regulation of small GTPase mediated signal transduction
GO:0022607	0.323	cellular component assembly
GO:0071704	0.302	organic substance metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005622	0.999	intracellular anatomical structure
GO:0005925	0.998	focal adhesion
GO:0005829	0.977	cytosol
GO:0043226	0.961	organelle
GO:0043229	0.939	intracellular organelle
GO:0043231	0.703	intracellular membrane-bounded organelle
GO:0043232	0.594	intracellular non-membrane-bounded organelle
GO:0071944	0.535	cell periphery
GO:0005886	0.467	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]