StarFunc result for job id Q68D91

User Input

>input (279 residues)
MSALEWYAHKSLGDGIFWIQERFYESGNRANIWLVRGSEQDVVIDTGLGLRSLPEYLYSS
GLLQDREAKEDAARRPLLAVATHVHFDHSGGLYQFDRVAVHHAEAEALARGDNFETVTWL
SDSEVVRTPSPGWRARQFRVQAVQPTLILQDGDVINLGDRQLTVMHMPGHSRGSICLHDK
DRKILFSGDVVYDGSLIDWLPYSRISDYVGTCERLIELVDRGLVEKVLPGHFNTFGAERL
FRLASNYISKAGICHKVSTFAMRSLASLALRVTNSRTSP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q68D91	1.000	1.000	3.169E-60	279	1.000	1.000	Q68D91.pdb.gz	MBLC2_HUMAN Acyl-coenzyme A thioesterase MBLAC2 OS=Homo sapiens OX=9606 GN=MBLAC2 PE=1 SV=3
2	AFDB:P75849	0.582	0.735	4.343E-13	215	0.176	0.228	P75849.pdb.gz	GLO22_ECOLI Hydroxyacylglutathione hydrolase GloC OS=Escherichia coli (strain K12) OX=83333 GN=gloC PE=1 SV=1
3	PDB:3faiA	0.617	0.741	1.067E-12	227	0.140	0.172	3faiA.pdb.gz	The structure of the dizinc subclass B2 metallo-beta-lactamase CphA reveals that the second inhibitory zinc ion binds in the histidine site
4	PDB:4ad9A	0.553	0.537	2.194E-12	288	0.179	0.174	4ad9A.pdb.gz	Identification of Lactb2, a Metallo-Beta-Lactamase Protein, as a Human Mitochondrial Endoribonuclease
5	PDB:1hlkA	0.617	0.742	3.547E-12	227	0.147	0.181	1hlkA.pdb.gz	Identification of a series of tricyclic natural products as potent broad spectrum inhibitors of metallo-beta-lactamases
6	AFDB:O86346	0.630	0.294	7.309E-12	644	0.179	0.078	O86346.pdb.gz	O86346_MYCTU Possible bifunctional enzyme: 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase (HHDD isomerase) + cyclase/dehydrase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv0939 PE=1 SV=1
7	AFDB:A0A096ZEC9	0.584	0.504	7.761E-12	328	0.140	0.119	A0A096ZEC9.pdb.gz	DNHA_NOCS1 2,4-dinitroanisole O-demethylase subunit alpha OS=Nocardioides sp. (strain JS1661) OX=1517491 GN=dnhA PE=1 SV=1
8	AFDB:P26918	0.614	0.667	8.242E-12	254	0.140	0.154	P26918.pdb.gz	BLAB_AERHY Metallo-beta-lactamase type 2 OS=Aeromonas hydrophila OX=644 GN=cphA PE=1 SV=1
9	AFDB:P32717	0.582	0.266	8.242E-12	661	0.118	0.050	P32717.pdb.gz	LPAKS_ECOLI Linear primary-alkylsulfatase OS=Escherichia coli (strain K12) OX=83333 GN=yjcS PE=1 SV=2
10	AFDB:E5BDC6	0.524	0.546	9.294E-12	266	0.176	0.184	E5BDC6.pdb.gz	E5BDC6_KLEPN Metallo-beta-lactamase VIM-26 OS=Klebsiella pneumoniae OX=573 GN=blaVIM-26 PE=1 SV=1
11	AFDB:P25910	0.602	0.666	9.869E-12	249	0.136	0.153	P25910.pdb.gz	BLAB_BACFG Metallo-beta-lactamase type 2 OS=Bacteroides fragilis OX=817 GN=ccrA PE=1 SV=1
12	AFDB:Q53H82	0.560	0.544	1.113E-11	288	0.179	0.174	Q53H82.pdb.gz	LACB2_HUMAN Endoribonuclease LACTB2 OS=Homo sapiens OX=9606 GN=LACTB2 PE=1 SV=2
13	AFDB:Q99KR3	0.548	0.532	1.113E-11	288	0.183	0.177	Q99KR3.pdb.gz	LACB2_MOUSE Endoribonuclease LACTB2 OS=Mus musculus OX=10090 GN=Lactb2 PE=1 SV=1
14	PDB:4uwpB	0.587	0.695	1.412E-11	230	0.161	0.196	4uwpB.pdb.gz	Structural and Biochemical Characterization of Vim-26 Show that Leu224 Has Implications for the Substrate Specificity of Vim Metallo-Beta-Lactamases.
15	PDB:2q0jA	0.579	0.526	6.339E-11	310	0.201	0.181	2q0jA.pdb.gz	Structure elucidation and preliminary assessment of hydrolase activity of PqsE, the Pseudomonas quinolone signal (PQS) response protein.
16	PDB:3adrA	0.527	0.565	6.339E-11	259	0.176	0.189	3adrA.pdb.gz	The first crystal structure of an archaeal metallo-beta-lactamase superfamily protein; ST1585 from Sulfolobus tokodaii
17	PDB:2m5cA	0.607	0.732	6.731E-11	227	0.143	0.176	2m5cA.pdb.gz	Solution structures of the Bacillus cereus metallo-beta-lactamase BcII and its complex with the broad spectrum inhibitor R-thiomandelic acid.
18	PDB:6jkaC	0.609	0.728	8.559E-11	228	0.147	0.180	6jkaC.pdb.gz	Identification of the Inhibitory Compounds for Metallo-beta-lactamases and Structural Analysis of the Binding Modes.
19	PDB:4pdxA	0.573	0.278	1.088E-10	622	0.122	0.055	4pdxA.pdb.gz
20	PDB:5evdA	0.533	0.554	1.088E-10	267	0.179	0.187	5evdA.pdb.gz	Cross-class metallo-beta-lactamase inhibition by bisthiazolidines reveals multiple binding modes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q68D91	0.0	575	279	1.000	1.000	MBLC2_HUMAN Acyl-coenzyme A thioesterase MBLAC2 OS=Homo sapiens OX=9606 GN=MBLAC2 PE=1 SV=3
2	P75849	4.37e-09	57.4	215	0.194	0.251	GLO22_ECOLI Hydroxyacylglutathione hydrolase GloC OS=Escherichia coli (strain K12) OX=83333 GN=gloC PE=1 SV=1
3	Q99KR3	1.50e-06	50.8	288	0.176	0.170	LACB2_MOUSE Endoribonuclease LACTB2 OS=Mus musculus OX=10090 GN=Lactb2 PE=1 SV=1
4	Q53H82	1.63e-06	50.8	288	0.183	0.177	LACB2_HUMAN Endoribonuclease LACTB2 OS=Homo sapiens OX=9606 GN=LACTB2 PE=1 SV=2
5	O86346	4.67e-05	47.0	644	0.194	0.084	O86346_MYCTU Possible bifunctional enzyme: 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase (HHDD isomerase) + cyclase/dehydrase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv0939 PE=1 SV=1
6	O94250	1.49e-04	44.7	256	0.100	0.109	GLO22_SCHPO Probable hydroxyacylglutathione hydrolase C13B11.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC13B11.03c PE=3 SV=1
7	M0QXB5	0.001	42.0	260	0.129	0.138	M0QXB5_HUMAN ETHE1 persulfide dioxygenase OS=Homo sapiens OX=9606 GN=ETHE1 PE=1 SV=1
8	O53534	0.001	42.0	211	0.172	0.227	O53534_MYCTU Metallo-beta-lactamase domain-containing protein OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv2260 PE=1 SV=3
9	A0A0S2Z5B3	0.002	41.6	254	0.129	0.142	A0A0S2Z5B3_HUMAN Ethylmalonic encephalopathy 1 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=ETHE1 PE=2 SV=1
10	O95571	0.002	41.6	254	0.129	0.142	ETHE1_HUMAN Persulfide dioxygenase ETHE1, mitochondrial OS=Homo sapiens OX=9606 GN=ETHE1 PE=1 SV=2
11	P20581	0.002	41.2	301	0.172	0.159	PQSE_PSEAE 2-aminobenzoylacetyl-CoA thioesterase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=pqsE PE=1 SV=1
12	C0H490	0.003	40.8	263	0.104	0.110	C0H490_PLAF7 Cytosolic glyoxalase II OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0406400 PE=3 SV=1
13	Q05584	0.007	39.7	274	0.143	0.146	GLO2_YEAST Hydroxyacylglutathione hydrolase, cytoplasmic isozyme OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GLO2 PE=1 SV=1
14	Q9DCM0	0.008	39.3	254	0.129	0.142	ETHE1_MOUSE Persulfide dioxygenase ETHE1, mitochondrial OS=Mus musculus OX=10090 GN=Ethe1 PE=1 SV=2
15	Q8RWE1	0.011	39.3	355	0.118	0.093	Q8RWE1_ARATH Metallo-beta-lactamase family protein OS=Arabidopsis thaliana OX=3702 GN=At4g33540 PE=1 SV=1
16	Q9UT36	0.013	38.5	256	0.168	0.184	GLO21_SCHPO Probable hydroxyacylglutathione hydrolase C824.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC824.07 PE=3 SV=1
17	O69645	0.024	37.7	264	0.190	0.201	O69645_MYCTO Metallo-beta-lactamase superfamily protein OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT3778 PE=4 SV=1
18	Q4WQZ6	0.047	37.4	421	0.154	0.102	TPCB_ASPFU Atrochrysone carboxyl ACP thioesterase OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=tpcB PE=2 SV=1
19	Q8LDW8	0.058	37.0	331	0.125	0.106	GLO2D_ARATH Probable hydroxyacylglutathione hydrolase 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=GLX2-4 PE=2 SV=1
20	Q9SID3	0.059	37.0	324	0.065	0.056	GLO2N_ARATH Hydroxyacylglutathione hydrolase 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At2g31350 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16301 DUF4943	2.7e+02	13.1	Domain of unknown function (DUF4943)
2	PF00753 Lactamase_B	2.6e-17	75.0	Metallo-beta-lactamase superfamily
3	PF12706 Lactamase_B_2	12	16.8	Beta-lactamase superfamily domain
4	PF19583 ODP	0.18	23.1	ODP family beta lactamase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000314776

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000314518	0.720	LysM and putative peptidoglycan-binding domain-containing protein 3
2	9606.ENSP00000365756	0.718	Uncharacterized protein KIAA2013
3	9606.ENSP00000480740	0.683	Leucine-rich repeat-containing protein 39
4	9606.ENSP00000433427	0.637	ADP-ribosylation factor-like protein 15
5	9606.ENSP00000382058	0.605	DNA-directed RNA polymerase III subunit RPC7
6	9606.ENSP00000366275	0.572	Metal transporter CNNM4
7	9606.ENSP00000381150	0.562	Metallo-beta-lactamase domain containing 1
8	9606.ENSP00000268099	0.550	Secretory carrier-associated membrane protein 2
9	9606.ENSP00000251527	0.545	Extended synaptotagmin-2
10	9606.ENSP00000428259	0.531	Centrin-3
11	9606.ENSP00000374353	0.530	Hydroxyacylglutathione hydrolase-like protein
12	9606.ENSP00000359685	0.526	Protein tyrosine phosphatase type IVA 1
13	9606.ENSP00000384582	0.504	G-protein coupled receptor 98

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0016290	1.000	palmitoyl-CoA hydrolase activity
GO:0008800	0.999	beta-lactamase activity
GO:0046872	0.955	metal ion binding
GO:0046914	0.670	transition metal ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.997	cellular metabolic process
GO:0071704	0.973	organic substance metabolic process
GO:0006807	0.579	nitrogen compound metabolic process
GO:0065007	0.525	biological regulation
GO:0044281	0.462	small molecule metabolic process
GO:0044238	0.385	primary metabolic process
GO:0050789	0.336	regulation of biological process
GO:0050794	0.326	regulation of cellular process
GO:1901360	0.307	organic cyclic compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0005886	0.997	plasma membrane
GO:0031982	0.996	vesicle
GO:0012505	0.995	endomembrane system
GO:0043230	0.985	extracellular organelle
GO:0005615	0.972	extracellular space
GO:1903561	0.971	extracellular vesicle
GO:0070062	0.961	extracellular exosome
GO:0031090	0.923	organelle membrane
GO:0031984	0.905	organelle subcompartment
GO:0005783	0.890	endoplasmic reticulum
GO:0098827	0.842	endoplasmic reticulum subcompartment
GO:0005789	0.826	endoplasmic reticulum membrane
GO:0005634	0.791	nucleus
GO:0031974	0.311	membrane-enclosed lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:16645	1.000	H2O + hexadecanoyl-CoA = CoA + H(+) + hexadecanoate
EC:3.1.2.2	1.000	palmitoyl-CoA hydrolase.
RHEA:20401	0.999	a beta-lactam + H2O = a substituted beta-amino acid
EC:3.5.2.6	0.999	beta-lactamase.

[back to server]