StarFunc result for job id Q68DA7

User Input

>input (1419 residues)
MEGTHCTLQLHKPITELCYISFCLPKGEVRGFSYKGTVTLDRSNKGFHNCYQVREESDII
SLSQEPDEHPGDIFFKQTPTKDILTELYKLTTERERLLTNLLSSDHILGITMGNQEGKLQ
ELSVSLAPEDDCFQSAGDWQGELPVGPLNKRSTHGNKKPRRSSGRRESFGALPQKRTKRK
GRGGRESAPLMGKDKICSSHSLPLSRTRPNLWVLEEKGNLLPNGALACSLQRRESCPPDI
PKTPDTDLGFGSFETAFKDTGLGREVLPPDCSSTEAGGDGIRRPPSGLEHQQTGLSESHQ
DPEKHPEAEKDEMEKPAKRTCKQKPVSKVVAKVQDLSSQVQRVVKTHSKGKETIAIRPAA
HAEFVPKADLLTLPGAEAGAHGSRRQGKERQGDRSSQSPAGETASISSVSASAEGAVNKV
PLKVIESEKLDEAPEGKRLGFPVHTSVPHTRPETRNKRRAGLPLGGHKSLFLDLPHKVGP
DSSQPRGDKKKPSPPAPAALGKVFNNSASQSSTHKQTSPVPSPLSPRLPSPQQHHRILRL
PALPGEREAALNDSPCRKSRVFSGCVSADTLEPPSSAKVTETKGASPAFLRAGQPRLVPG
ETLEKSLGPGKTTAEPQHQSPPGISSEGFPWDGFNEQTPKDLPNRDGGAWVLGYRAGPAC
PFLLHEEREKSNRSELYLDLHPDHSLTEQDDRTPGRLQAVWPPPKTKDTEEKVGLKYTEA
EYQAAILHLKREHKEEIENLQAQFELRAFHIRGEHAMITARLEETIENLKHELEHRWRGG
CEERKDVCISTDDDCPPKTFRNVCVQTDRETFLKPCESESKTTRSNQLVPKKLNISSLSQ
LSPPNDHKDIHAALQPMEGMASNQQKALPPPPASIPPPPPLPSGLGSLSPAPPMPPVSAG
PPLPPPPPPPPPLPPPSSAGPPPPPPPPPLPNSPAPPNPGGPPPAPPPPGLAPPPPPGLF
FGLGSSSSQCPRKPAIEPSCPMKPLYWTRIQISDRSQNATPTLWDSLEEPDIRDPSEFEY
LFSKDTTQQKKKPLSETYEKKNKVKKIIKLLDGKRSQTVGILISSLHLEMKDIQQAIFNV
DDSVVDLETLAALYENRAQEDELVKIRKYYETSKEEELKLLDKPEQFLHELAQIPNFAER
AQCIIFRSVFSEGITSLHRKVEIITRASKDLLHVKSVKDILALILAFGNYMNGGNRTRGQ
ADGYSLEILPKLKDVKSRDNGINLVDYVVKYYLRYYDQEAGTEKSVFPLPEPQDFFLASQ
VKFEDLIKDLRKLKRQLEASEKQMVVVCKESPKEYLQPFKDKLEEFFQKAKKEHKMEESH
LENAQKSFETTVRYFGMKPKSGEKEITPSYVFMVWYEFCSDFKTIWKRESKNISKERLKM
AQESVSKLTSEKKVETKKINPTASLKERLRQKEASVTTN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q05860	0.453	0.441	0.000	1466	0.760	0.736	Q05860.pdb.gz	FMN1_MOUSE Formin-1 OS=Mus musculus OX=10090 GN=Fmn1 PE=1 SV=2
2	AFDB:Q9NZ56	0.277	0.232	2.827E-44	1722	0.303	0.250	Q9NZ56.pdb.gz	FMN2_HUMAN Formin-2 OS=Homo sapiens OX=9606 GN=FMN2 PE=1 SV=4
3	AFDB:Q9JL04	0.284	0.258	4.967E-43	1578	0.299	0.269	Q9JL04.pdb.gz	FMN2_MOUSE Formin-2 OS=Mus musculus OX=10090 GN=Fmn2 PE=1 SV=2
4	AFDB:Q9SE97	0.239	0.312	9.384E-18	1051	0.140	0.189	Q9SE97.pdb.gz	FH1_ARATH Formin-like protein 1 OS=Arabidopsis thaliana OX=3702 GN=FH1 PE=1 SV=1
5	AFDB:E1JI78	0.212	0.124	1.821E-6	2528	0.186	0.104	E1JI78.pdb.gz	E1JI78_DROME Formin homology 2 domain containing, isoform I OS=Drosophila melanogaster OX=7227 GN=Fhos PE=4 SV=2
6	AFDB:Q13796	0.050	0.046	2.191E-3	1616	0.146	0.128	Q13796.pdb.gz	SHRM2_HUMAN Protein Shroom2 OS=Homo sapiens OX=9606 GN=SHROOM2 PE=1 SV=1
7	AFDB:Q09JY9	0.055	0.048	6.380E-3	1726	0.149	0.123	Q09JY9.pdb.gz	SHRM2_XENTR Protein Shroom2 OS=Xenopus tropicalis OX=8364 GN=shroom2 PE=2 SV=1
8	AFDB:O88573	0.054	0.060	7.748E-3	1216	0.128	0.149	O88573.pdb.gz	AFF1_MOUSE AF4/FMR2 family member 1 OS=Mus musculus OX=10090 GN=Aff1 PE=1 SV=2
9	AFDB:Q12774	0.058	0.054	1.089E-2	1597	0.159	0.142	Q12774.pdb.gz	ARHG5_HUMAN Rho guanine nucleotide exchange factor 5 OS=Homo sapiens OX=9606 GN=ARHGEF5 PE=1 SV=3
10	AFDB:F4IZK5	0.071	0.071	1.457E-2	1403	0.125	0.126	F4IZK5.pdb.gz	F4IZK5_ARATH CW-type Zinc Finger OS=Arabidopsis thaliana OX=3702 GN=At3g62900 PE=1 SV=2
11	PDB:7l08AV	0.053	0.137	6.937E-2	367	0.030	0.114	7l08AV.pdb.gz	Distinct mechanisms of the human mitoribosome recycling and antibiotic resistance.
12	PDB:1qoyA	0.060	0.186	7.645E-2	303	0.023	0.109	1qoyA.pdb.gz
13	PDB:6iemB	0.054	0.106	4.613E-1	462	0.027	0.084	6iemB.pdb.gz
14	PDB:6ygbB	0.047	0.075	5.603E-1	725	0.030	0.059	6ygbB.pdb.gz	Divergent architecture of the heterotrimeric NatC complex explains N-terminal acetylation of cognate substrates.
15	PDB:6uw9A	0.040	0.077	6.174E-1	582	0.030	0.074	6uw9A.pdb.gz
16	PDB:3c98B	0.053	0.198	7.499E-1	230	0.018	0.113	3c98B.pdb.gz
17	PDB:6qdvT	0.038	0.062	7.499E-1	639	0.027	0.061	6qdvT.pdb.gz	A human postcatalytic spliceosome structure reveals essential roles of metazoan factors for exon ligation.
18	PDB:7nj1A	0.042	0.041	8.264E-1	1448	0.027	0.027	7nj1A.pdb.gz
19	PDB:4q4aA	0.047	0.089	9.107E-1	572	0.027	0.068	4q4aA.pdb.gz	Structural basis for allosteric cross-talk between the asymmetric nucleotide binding sites of a heterodimeric ABC exporter.
20	PDB:1yvlB	0.036	0.067	1.004	653	0.027	0.060	1yvlB.pdb.gz	Structural bases of unphosphorylated STAT1 association and receptor binding.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q05860	0.0	1127	1466	0.414	0.401	FMN1_MOUSE Formin-1 OS=Mus musculus OX=10090 GN=Fmn1 PE=1 SV=2
2	Q9NZ56	1.13e-149	499	1722	0.173	0.142	FMN2_HUMAN Formin-2 OS=Homo sapiens OX=9606 GN=FMN2 PE=1 SV=4
3	Q9JL04	2.47e-146	488	1578	0.170	0.153	FMN2_MOUSE Formin-2 OS=Mus musculus OX=10090 GN=Fmn2 PE=1 SV=2
4	Q24120	8.93e-74	270	1059	0.121	0.162	CAPU_DROME Protein cappuccino OS=Drosophila melanogaster OX=7227 GN=capu PE=1 SV=2
5	Q1ZXK2	7.31e-33	141	1074	0.106	0.140	FORG_DICDI Formin-G OS=Dictyostelium discoideum OX=44689 GN=forG PE=1 SV=1
6	B3DJI0	9.92e-32	137	1069	0.080	0.107	B3DJI0_DANRE Daam1l protein OS=Danio rerio OX=7955 GN=daam1l PE=1 SV=1
7	Q5RHJ3	6.46e-31	135	1079	0.080	0.105	Q5RHJ3_DANRE Disheveled-associated activator of morphogenesis 1 OS=Danio rerio OX=7955 GN=daam1l PE=1 SV=1
8	A0A1D5P556	2.20e-30	133	1075	0.083	0.110	DAAM2_CHICK Disheveled-associated activator of morphogenesis 2 OS=Gallus gallus OX=9031 GN=DAAM2 PE=1 SV=2
9	A0A0R4IER9	9.15e-29	127	1060	0.081	0.108	A0A0R4IER9_DANRE Disheveled-associated activator of morphogenesis 1 isoform X2 OS=Danio rerio OX=7955 GN=daam1a PE=4 SV=1
10	M9MSM5	3.45e-27	123	1463	0.075	0.072	M9MSM5_DROME Dishevelled associated activator of morphogenesis, isoform D OS=Drosophila melanogaster OX=7227 GN=DAAM PE=4 SV=1
11	Q54N00	1.32e-26	120	1087	0.096	0.125	FORH_DICDI Formin-H OS=Dictyostelium discoideum OX=44689 GN=forH PE=1 SV=1
12	Q8IRY0	1.51e-26	120	1153	0.075	0.093	Q8IRY0_DROME Dishevelled associated activator of morphogenesis, isoform B OS=Drosophila melanogaster OX=7227 GN=DAAM PE=4 SV=1
13	Q7YZA4	3.55e-26	119	1114	0.075	0.096	Q7YZA4_DROME Dishevelled associated activator of morphogenesis, isoform A OS=Drosophila melanogaster OX=7227 GN=DAAM PE=1 SV=1
14	Q86T65	5.23e-26	119	1068	0.078	0.104	DAAM2_HUMAN Disheveled-associated activator of morphogenesis 2 OS=Homo sapiens OX=9606 GN=DAAM2 PE=1 SV=3
15	Q8MT16	1.11e-25	117	1114	0.075	0.095	Q8MT16_DROME RH61354p OS=Drosophila melanogaster OX=7227 GN=DAAM PE=2 SV=1
16	Q5BII2	1.51e-24	114	1011	0.070	0.099	Q5BII2_DROME RE67944p OS=Drosophila melanogaster OX=7227 GN=DAAM PE=2 SV=1
17	Q5TJ56	1.22e-23	111	1220	0.101	0.118	FORF_DICDI Formin-F OS=Dictyostelium discoideum OX=44689 GN=forF PE=1 SV=1
18	Q8BPM0	7.41e-23	108	1077	0.072	0.095	DAAM1_MOUSE Disheveled-associated activator of morphogenesis 1 OS=Mus musculus OX=10090 GN=Daam1 PE=1 SV=4
19	Q80U19	4.65e-21	102	1115	0.083	0.106	DAAM2_MOUSE Disheveled-associated activator of morphogenesis 2 OS=Mus musculus OX=10090 GN=Daam2 PE=1 SV=4
20	Q54KF1	7.86e-21	102	1158	0.068	0.083	FORC_DICDI Formin-C OS=Dictyostelium discoideum OX=44689 GN=forC PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02181 FH2	3e-87	304.8	Formin Homology 2 Domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000479134

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000400175	0.985	Transforming protein RhoA
2	9606.ENSP00000304669	0.974	Catenin alpha-1
3	9606.ENSP00000383118	0.963	Cell division control protein 42 homolog
4	9606.ENSP00000413625	0.942	Formin-binding protein 1
5	9606.ENSP00000261769	0.941	Cadherin-1
6	9606.ENSP00000344456	0.941	Catenin beta-1
7	9606.ENSP00000382004	0.936	Catenin delta-1
8	9606.ENSP00000367494	0.916	Protein spire homolog 2
9	9606.ENSP00000377508	0.910	Junction plakoglobin
10	9606.ENSP00000387266	0.897	Protein spire homolog 1
11	9606.ENSP00000225655	0.862	Profilin-1
12	9606.ENSP00000272233	0.831	Rho-related GTP-binding protein RhoB
13	9606.ENSP00000285735	0.822	Rho-related GTP-binding protein RhoC
14	9606.ENSP00000265748	0.810	Anillin
15	9606.ENSP00000367220	0.808	Actin-related protein 2
16	9606.ENSP00000365891	0.807	Wiskott-Aldrich syndrome protein
17	9606.ENSP00000479322	0.807	CAP-Gly domain-containing linker protein 1
18	9606.ENSP00000223023	0.797	Neural Wiskott-Aldrich syndrome protein
19	9606.ENSP00000478319	0.796	Gremlin-1
20	9606.ENSP00000239940	0.795	Profilin-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0017124	0.995	SH3 domain binding
GO:0008092	0.629	cytoskeletal protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.975	cellular process
GO:0050794	0.974	regulation of cellular process
GO:0071840	0.956	cellular component organization or biogenesis
GO:0016043	0.949	cellular component organization
GO:0032501	0.895	multicellular organismal process
GO:0048522	0.841	positive regulation of cellular process
GO:0051128	0.756	regulation of cellular component organization
GO:0032502	0.725	developmental process
GO:0033043	0.696	regulation of organelle organization
GO:0048856	0.682	anatomical structure development
GO:0006996	0.427	organelle organization
GO:0007275	0.415	multicellular organism development
GO:0044087	0.408	regulation of cellular component biogenesis
GO:0050896	0.324	response to stimulus
GO:0051493	0.305	regulation of cytoskeleton organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0005634	0.993	nucleus
GO:0005829	0.940	cytosol
GO:0016020	0.870	membrane
GO:0043232	0.824	intracellular non-membrane-bounded organelle
GO:0071944	0.687	cell periphery
GO:0005856	0.574	cytoskeleton
GO:0070013	0.499	intracellular organelle lumen
GO:0031981	0.370	nuclear lumen
GO:0005654	0.308	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]