StarFunc result for job id Q68DE3

User Input

>input (2245 residues)
MPEMTENETPTKKQHRKKNRETHNAVERHRKKKINAGINRIGELIPCSPALKQSKNMILD
QAFKYITELKRQNDELLLNGGNNEQAEEIKKLRKQLEEIQKENGRYIELLKANDICLYDD
PTIHWKGNLKNSKVSVVIPSDQVQKKIIVYSNGNQPGGNSQGTAVQGITFNVSHNLQKQT
ANVVPVQRTCNLVTPVSISGVYPSENKPWHQTTVPALATNQPVPLCLPAAISAQSILELP
TSESESNVLGATSGSLIAVSIESEPHQHHSLHTCLNDQNSSENKNGQENPKVLKKMTPCV
TNIPHSSSATATKVHHGNKSCLSIQDFRGDFQNTFVVSVTTTVCSQPPRTAGDSSPMSIS
KSADLTSTATVVASSAPGVGKATIPISTLSGNPLDNGWTLSCSLPSSSVSTSDLKNINSL
TRISSAGNTQTTWTTLQLAGNTIQPLSQTPSSAVTPVLNESGTSPTTSNHSRYVATDINL
NNSFPADGQPVEQVVVTLPSCPSLPMQPLIAQPQVKSQPPKNILPLNSAMQVIQMAQPVG
SAVNSAPTNQNVIILQPPSTTPCPTVMRAEVSNQTVGQQIVIIQAANQNPLPLLPAPPPG
SVRLPINGANTVIGSNNSVQNVPTPQTFGGKHLVHILPRPSSLSASNSTQTFSVTMSNQQ
PQTISLNGQLFALQPVMSSSGTTNQTPMQIIQPTTSEDPNTNVALNTFGALASLNQSISQ
MAGQSCVQLSISQPANSQTAANSQTTTANCVSLTTTAAPPVTTDSSATLASTYNLVSTSS
MNTVACLPNMKSKRLNKKPGGRKHLAANKSACPLNSVRDVSKLDCPNTEGSAEPPCNDGL
LESFPAVLPSVSVSQANSVSVSASHSLGVLSSESLIPESVSKSKSAEKSSPPSQESVTSE
HFAMAAAKSKDSTPNLQQETSQDKPPSSLALSDAAKPCASANVLIPSPSDPHILVSQVPG
LSSTTSTTSTDCVSEVEIIAEPCRVEQDSSDTMQTTGLLKGQGLTTLLSDLAKKKNPQKS
SLSDQMDHPDFSSENPKIVDSSVNLHPKQELLLMNNDDRDPPQHHSCLPDQEVINGSLIN
GRQADSPMSTSSGSSRSFSVASMLPETTREDVTSNATTNTCDSCTFVEQTDIVALAARAI
FDQENLEKGRVGLQADIREVASKPSEASLLEGDPPFKSQIPKESGTGQAEATPNEFNSQG
SIEATMERPLEKPSCSLGIKTSNASLQDSTSQPPSITSLSVNNLIHQSSISHPLASCAGL
SPTSEQTTVPATVNLTVSSSSYGSQPPGPSLMTEYSQEQLNTMTSTIPNSQIQEPLLKPS
HESRKDSAKRAVQDDLLLSSAKRQKHCQPAPLRLESMSLMSRTPDTISDQTQMMVSQIPP
NSSNSVVPVSNPAHGDGLTRLFPPSNNFVTPALRQTEVQCGSQPSVAEQQQTQASQHLQA
LQQHVPAQGVSHLHSNHLYIKQQQQQQQQQQQQQQQQQAGQLRERHHLYQMQHHVPHAES
SVHSQPHNVHQQRTLQQEVQMQKKRNLVQGTQTSQLSLQPKHHGTDQSRSKTGQPHPHHQ
QMQQQMQQHFGSSQTEKSCENPSTSRNHHNHPQNHLNQDIMHQQQDVGSRQQGSGVSSEH
VSGHNPMQRLLTSRGLEQQMVSQPSIVTRSSDMTCTPHRPERNRVSSYSAEALIGKTSSN
SEQRMGISIQGSRVSDQLEMRSYLDVPRNKSLAIHNMQGRVDHTVASDIRLSDCQTFKPS
GASQQPQSNFEVQSSRNNEIGNPVSSLRSMQSQAFRISQNTGPPPIDRQKRLSYPPVQSI
PTGNGIPSRDSENTCHQSFMQSLLAPHLSDQVIGSQRSLSEHQRNTQCGPSSAIEYNCPP
THENVHIRRESESQNRESCDMSLGAINTRNSTLNIPFSSSSSSGDIQGRNTSPNVSVQKS
NPMRITESHATKGHMNPPVTTNMHGVARPALPHPSVSHGNGDQGPAVRQANSSVPQRSRH
PLQDSSGSKIRQPERNRSGNQRQSTVFDPSLPHLPLSTGGSMILGRQQPATEKRGSIVRF
MPDSPQVPNDNSGPDQHTLSQNFGFSFIPEGGMNPPINANASFIPQVTQPSATRTPALIP
VDPQNTLPSFYPPYSPAHPTLSNDISIPYFPNQMFSNPSTEKVNSGSLNNRFGSILSPPR
PVGFAQPSFPLLPDMPPMHMTNSHLSNFNMTSLFPEIATALPDGSAMSPLLTIANSSASD
SSKQSSNRPAHNISHILGHDCSSAV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q68DE3	0.999	0.999	0.000	2245	1.000	1.000	Q68DE3.pdb.gz	USF3_HUMAN Basic helix-loop-helix domain-containing protein USF3 OS=Homo sapiens OX=9606 GN=USF3 PE=1 SV=4
2	AFDB:Q68DN1	0.024	0.026	2.038E-3	1984	0.140	0.158	Q68DN1.pdb.gz	CB016_HUMAN Uncharacterized protein C2orf16 OS=Homo sapiens OX=9606 GN=C2orf16 PE=2 SV=3
3	AFDB:F1R5H6	0.032	0.043	1.327E-1	1444	0.082	0.127	F1R5H6.pdb.gz	BRD4_DANRE Bromodomain-containing protein 4 OS=Danio rerio OX=7955 GN=brd4 PE=1 SV=1
4	AFDB:D3ZGB1	0.028	0.034	1.703E-1	1548	0.104	0.151	D3ZGB1.pdb.gz	NFAT5_RAT Nuclear factor of activated T-cells 5 OS=Rattus norvegicus OX=10116 GN=Nfat5 PE=1 SV=1
5	AFDB:Q56A10	0.025	0.035	2.985E-1	1511	0.099	0.147	Q56A10.pdb.gz	ZN608_MOUSE Zinc finger protein 608 OS=Mus musculus OX=10090 GN=Znf608 PE=1 SV=1
6	AFDB:E7FF48	0.033	0.033	3.177E-1	2315	0.133	0.129	E7FF48.pdb.gz	E7FF48_DANRE Nuclear receptor corepressor 2 OS=Danio rerio OX=7955 GN=SMRT PE=1 SV=2
7	AFDB:Q7Z589	0.031	0.042	4.618E-1	1322	0.094	0.160	Q7Z589.pdb.gz	EMSY_HUMAN BRCA2-interacting transcriptional repressor EMSY OS=Homo sapiens OX=9606 GN=EMSY PE=1 SV=2
8	AFDB:Q9QX47	0.031	0.029	4.618E-1	2444	0.155	0.143	Q9QX47.pdb.gz	SON_MOUSE Protein SON OS=Mus musculus OX=10090 GN=Son PE=1 SV=2
9	AFDB:Q9EPQ8	0.025	0.028	6.306E-1	1987	0.131	0.148	Q9EPQ8.pdb.gz	TCF20_MOUSE Transcription factor 20 OS=Mus musculus OX=10090 GN=Tcf20 PE=1 SV=3
10	AFDB:Q3UHK8	0.030	0.035	7.144E-1	1896	0.140	0.166	Q3UHK8.pdb.gz	TNR6A_MOUSE Trinucleotide repeat-containing gene 6A protein OS=Mus musculus OX=10090 GN=Tnrc6a PE=1 SV=2
11	PDB:3ojaA	0.030	0.125	4.753	482	0.008	0.035	3ojaA.pdb.gz	A heterodimeric complex of the LRR proteins LRIM1 and APL1C regulates complement-like immunity in Anopheles gambiae.
12	PDB:2bskD	0.021	0.274	7.825	90	0.008	0.200	2bskD.pdb.gz
13	PDB:3ejbH	0.015	0.078	7.825	387	0.000	0.003	3ejbH.pdb.gz	Structural insights from a P450 Carrier Protein complex reveal how specificity is achieved in the P450(BioI) ACP complex.
14	PDB:6pmiF	0.023	0.107	8.329	239	0.006	0.054	6pmiF.pdb.gz	Structural basis of bacterial sigma28-mediated transcription reveals roles of the RNA polymerase zinc-binding domain.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q68DE3	0.0	4541	2245	1.000	1.000	USF3_HUMAN Basic helix-loop-helix domain-containing protein USF3 OS=Homo sapiens OX=9606 GN=USF3 PE=1 SV=4
2	A0A0S2Z4U5	1.76e-05	51.6	310	0.016	0.116	A0A0S2Z4U5_HUMAN Upstream transcription factor 1 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=USF1 PE=2 SV=1
3	P22415	1.76e-05	51.6	310	0.016	0.116	USF1_HUMAN Upstream stimulatory factor 1 OS=Homo sapiens OX=9606 GN=USF1 PE=1 SV=1
4	Q61069	2.12e-05	51.2	310	0.016	0.116	USF1_MOUSE Upstream stimulatory factor 1 OS=Mus musculus OX=10090 GN=Usf1 PE=1 SV=1
5	Q15853	2.26e-05	51.2	346	0.017	0.113	USF2_HUMAN Upstream stimulatory factor 2 OS=Homo sapiens OX=9606 GN=USF2 PE=1 SV=1
6	Q63665	2.44e-05	51.2	346	0.017	0.113	USF2_RAT Upstream stimulatory factor 2 OS=Rattus norvegicus OX=10116 GN=Usf2 PE=1 SV=2
7	Q64705	2.44e-05	51.2	346	0.017	0.113	USF2_MOUSE Upstream stimulatory factor 2 OS=Mus musculus OX=10090 GN=Usf2 PE=1 SV=1
8	B1AQP1	3.23e-05	50.4	282	0.016	0.128	B1AQP1_HUMAN Upstream transcription factor 1 OS=Homo sapiens OX=9606 GN=USF1 PE=1 SV=1
9	Q9V406	4.88e-05	50.8	631	0.012	0.043	Q9V406_DROME Activator protein 4 OS=Drosophila melanogaster OX=7227 GN=crp PE=1 SV=1
10	Q86PC0	6.29e-05	50.4	543	0.012	0.050	Q86PC0_DROME RE01132p OS=Drosophila melanogaster OX=7227 GN=crp PE=2 SV=1
11	O75030	6.61e-05	50.4	526	0.014	0.059	MITF_HUMAN Microphthalmia-associated transcription factor OS=Homo sapiens OX=9606 GN=MITF PE=1 SV=2
12	P19532	7.01e-05	50.4	575	0.015	0.059	TFE3_HUMAN Transcription factor E3 OS=Homo sapiens OX=9606 GN=TFE3 PE=1 SV=4
13	A2AEW1	7.55e-05	50.4	572	0.015	0.059	A2AEW1_MOUSE Transcription factor E3 OS=Mus musculus OX=10090 GN=Tfe3 PE=1 SV=1
14	Q64092	7.62e-05	50.4	572	0.015	0.059	TFE3_MOUSE Transcription factor E3 OS=Mus musculus OX=10090 GN=Tfe3 PE=1 SV=2
15	O88368	1.49e-04	49.3	526	0.013	0.057	MITF_RAT Microphthalmia-associated transcription factor OS=Rattus norvegicus OX=10116 GN=Mitf PE=2 SV=2
16	Q08874	1.57e-04	49.3	526	0.013	0.057	MITF_MOUSE Microphthalmia-associated transcription factor OS=Mus musculus OX=10090 GN=Mitf PE=1 SV=4
17	E9PME6	2.05e-04	47.4	217	0.012	0.129	E9PME6_HUMAN Upstream transcription factor 1 (Fragment) OS=Homo sapiens OX=9606 GN=USF1 PE=1 SV=8
18	Q561Z2	2.13e-04	48.9	539	0.013	0.054	Q561Z2_DANRE Tfe3a protein OS=Danio rerio OX=7955 GN=cb873 PE=2 SV=1
19	Q9SVU7	4.05e-04	47.8	445	0.012	0.063	BH056_ARATH Putative transcription factor bHLH056 OS=Arabidopsis thaliana OX=3702 GN=BHLH56 PE=3 SV=2
20	C8VDK0	0.001	45.8	292	0.013	0.099	C8VDK0_EMENI PENR2 protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_07734 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00010 HLH	3.2e-07	41.5	Helix-loop-helix DNA-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000320794

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000414517	0.689	Mastermind-like domain-containing protein 1
2	9606.ENSP00000246912	0.667	Max-like protein X
3	9606.ENSP00000420714	0.638	Mitochondrial ribosomal protein S14
4	9606.ENSP00000288462	0.629	Uncharacterized protein C9orf43
5	9606.ENSP00000354597	0.625	DENN domain-containing protein 4B
6	9606.ENSP00000308717	0.618	Mitochondrial ribosomal protein L48
7	9606.ENSP00000384198	0.583	INO80 complex subunit D
8	9606.ENSP00000483713	0.580	Killer cell lectin-like receptor subfamily F member 1
9	9606.ENSP00000380517	0.579	Cadherin-24
10	9606.ENSP00000370022	0.570	Transcription factor COE4
11	9606.ENSP00000426421	0.559	Protein asteroid homolog 1
12	9606.ENSP00000405222	0.558	DDB1- and CUL4-associated factor 8-like protein 1
13	9606.ENSP00000426033	0.552	Hairy and enhancer of split-related protein HELT
14	9606.ENSP00000469142	0.537	Neuronal PAS domain-containing protein 1
15	9606.ENSP00000387111	0.527	annotation not available
16	9606.ENSP00000410186	0.524	Adenylate kinase 9
17	9606.ENSP00000320232	0.518	Coiled-coil domain containing 168
18	9606.ENSP00000427882	0.515	Ankyrin and armadillo repeat containing
19	9606.ENSP00000331152	0.512	Max-interacting protein 1
20	9606.ENSP00000285298	0.511	Mitochondrial ribosomal protein S17

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0001228	1.000	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0000977	1.000	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0005515	0.857	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.998	biological regulation
GO:0050794	0.988	regulation of cellular process
GO:0006355	0.958	regulation of DNA-templated transcription
GO:0048522	0.952	positive regulation of cellular process
GO:0031325	0.936	positive regulation of cellular metabolic process
GO:0048519	0.924	negative regulation of biological process
GO:0051173	0.898	positive regulation of nitrogen compound metabolic process
GO:0010604	0.884	positive regulation of macromolecule metabolic process
GO:0048523	0.854	negative regulation of cellular process
GO:0031328	0.838	positive regulation of cellular biosynthetic process
GO:0045935	0.838	positive regulation of nucleobase-containing compound metabolic process
GO:0006357	0.829	regulation of transcription by RNA polymerase II
GO:0010557	0.798	positive regulation of macromolecule biosynthetic process
GO:0051254	0.794	positive regulation of RNA metabolic process
GO:0010717	0.747	regulation of epithelial to mesenchymal transition
GO:0045893	0.747	positive regulation of DNA-templated transcription
GO:0051239	0.562	regulation of multicellular organismal process
GO:0009987	0.421	cellular process
GO:0045944	0.355	positive regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.996	nucleoplasm
GO:0005737	0.923	cytoplasm
GO:0043228	0.818	non-membrane-bounded organelle
GO:0043232	0.803	intracellular non-membrane-bounded organelle
GO:0016020	0.677	membrane
GO:0032991	0.667	protein-containing complex
GO:0005829	0.574	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]