StarFunc result for job id Q68DN1

User Input

>input (1984 residues)
MELTPGAQQQGINYQELTSGWQDVKSMMLVPEPTRKFPSGPLLTSVRFSNLSPESQQQDV
KSLEFTVEPKLQSVKHVKLSSVSLQQTIKSVELAPGSLPQRVKYGEQTPRTNYQIMESSE
LIPRPGHQFAKYAEMIPQPKYQIPKSANLISIPIYHATESSEMAQGLAYKGIDTVEKSVG
LTPKLTGRAKESLGMLLQPDLQVPKFVDLTPMVRDQGSKFLGLTPEKSYQILETMELLSQ
SRPRVKDVGELYMKPLQQTVEYEGITPELKHYFTEAMGLTAEARIQANEFFGMTPKPTSQ
ATGFAERSPRLCPQNLECVEVISEKRLQGEESVVLIPKSLHHVPDSASGMTPGLGHRVPE
SVELTSKSGVQVEKTLQLTPKPQHHVGSPGIISGLGHQVPESVNLTCKQWLQMEESLEVP
LKQTSQVIGHEESVELTSEARQHREVSMGLTKSKNQSMKSPGTTPGPLGRIVEFMRISPE
PLDQVTESARTQLQVAQSEEVILIDVPKVVQSVKVTPGPPFQIVKSVTIPRPTPQMVEYI
ELTPKLQYVRPSEHHTGPCLQDVKSTKLITKPKHQILETVELTGFQIVKTMLIPGPSLQI
VKSEELAPGPIPQVVEPIGVALESGIEAINCVDLLPRPHLQELIVPAELTPSPCTQVKSA
ELTSPQTSPFEEHTILTHKQGLQAVKSTVIKTEPPKVMETEDLNLGHVCQNRDCQKLTSE
ELQVGTDFSRFLQSSSTTLISSSVRTASELGGLWDSGIQEVSRALDIKNPGTDILQPEET
YIDPTMIQSLTFPLALHNQSSDKTANIVENPCPEILGVDVISKETTKRKQMEELENSLQR
HLPQSWRSRSRTFQAESGVQKGLIKSFPGRQHNVWESHAWRQRLPRKYLSTMLMLGNILG
TTMERKLCSQTSLAERATADTCQSIQNLFGIPAELMEPSQSLPEKGPVTISQPSVVKNYI
QRHTFYHGHKKRMALRIWTRGSTSSIIQQYSGTRVRIKKTNSTFNGISQEVIQHMPVSCA
GGQLPVLVKSESSLSIFYDREDLVPMEESEDSQSDSQTRISESQHSLKPNYLSQAKTDFS
EQFQLLEDLQLKIAAKLLRSQIPPDVPPPLASGLVLKYPICLQCGRCSGLNCHHKLQTTS
GPYLLIYPQLHLVRTPEGHGEVRLHLGFRLRIGKRSQISKYRERDRPVIRRSPISPSQRK
AKIYTQASKSPTSTIDLQSGPSQSPAPVQVYIRRGQRSRPDLVEKTKTRAPGHYEFTQVH
NLPESDSESTQNEKRAKVRTKKTSDSKYPMKRITKRLRKHRKFYTNSRTTIESPSRELAA
HLRRKRIGATQTSTASLKRQPKKPSQPKFMQLLFQSLKRAFQTAHRVIASVGRKPVDGTR
PDNLWASKNYYPKQNARDYCLPSSIKRDKRSADKLTPAGSTIKQEDILWGGTVQCRSAQQ
PRRAYSFQPRPLRLPKPTDSQSGIAFQTASVGQPLRTVQKDSSSRSKKNFYRNETSSQES
KNLSTPGTRVQARGRILPGSPVKRTWHRHLKDKLTHKEHNHPSFYRERTPRGPSERTRHN
PSWRNHRSPSERSQRSSLERRHHSPSQRSHCSPSRKNHSSPSERSWRSPSQRNHCSPPER
SCHSLSERGLHSPSQRSHRGPSQRRHHSPSERSHRSPSERSHRSSSERRHRSPSQRSHRG
PSERSHCSPSERRHRSPSQRSHRGPSERRHHSPSKRSHRSPARRSHRSPSERSHHSPSER
SHHSPSERRHHSPSERSHCSPSERSHCSPSERRHRSPSERRHHSPSEKSHHSPSERSHHS
PSERRRHSPLERSRHSLLERSHRSPSERRSHRSFERSHRRISERSHSPSEKSHLSPLERS
RCSPSERRGHSSSGKTCHSPSERSHRSPSGMRQGRTSERSHRSSCERTRHSPSEMRPGRP
SGRNHCSPSERSRRSPLKEGLKYSFPGERPSHSLSRDFKNQTTLLGTTHKNPKAGQVWRP
EATR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q68DN1	0.999	0.999	0.000	1984	1.000	1.000	Q68DN1.pdb.gz	CB016_HUMAN Uncharacterized protein C2orf16 OS=Homo sapiens OX=9606 GN=C2orf16 PE=2 SV=3
2	AFDB:D4AC33	0.032	0.033	3.687E-9	1920	0.122	0.127	D4AC33.pdb.gz	D4AC33_RAT Methylcytosine dioxygenase TET OS=Rattus norvegicus OX=10116 GN=Tet2 PE=3 SV=2
3	AFDB:Q4JK59	0.034	0.035	1.731E-8	1912	0.113	0.118	Q4JK59.pdb.gz	TET2_MOUSE Methylcytosine dioxygenase TET2 OS=Mus musculus OX=10090 GN=Tet2 PE=1 SV=3
4	AFDB:Q8INM3	0.033	0.043	5.269E-7	1420	0.113	0.158	Q8INM3.pdb.gz	SLE_DROME Protein slender lobes OS=Drosophila melanogaster OX=7227 GN=sle PE=1 SV=1
5	AFDB:Q6N021	0.029	0.029	5.994E-7	2002	0.120	0.119	Q6N021.pdb.gz	TET2_HUMAN Methylcytosine dioxygenase TET2 OS=Homo sapiens OX=9606 GN=TET2 PE=1 SV=3
6	AFDB:Q68FD9	0.030	0.031	1.218E-6	1940	0.123	0.126	Q68FD9.pdb.gz	K1549_MOUSE UPF0606 protein KIAA1549 OS=Mus musculus OX=10090 GN=Kiaa1549 PE=1 SV=3
7	AFDB:X2JEM2	0.032	0.029	2.474E-6	2326	0.119	0.101	X2JEM2.pdb.gz	X2JEM2_DROME Secretory 16, isoform I OS=Drosophila melanogaster OX=7227 GN=Sec16 PE=1 SV=1
8	AFDB:E7F958	0.026	0.028	3.885E-6	1715	0.102	0.118	E7F958.pdb.gz	E7F958_DANRE Methylcytosine dioxygenase TET OS=Danio rerio OX=7955 GN=tet2 PE=2 SV=1
9	AFDB:Q3LHL9	0.031	0.036	8.419E-6	1658	0.099	0.118	Q3LHL9.pdb.gz	WGE_DROME Protein winged eye OS=Drosophila melanogaster OX=7227 GN=wge PE=1 SV=1
10	AFDB:Q9HCM3	0.029	0.029	9.577E-6	1950	0.125	0.127	Q9HCM3.pdb.gz	K1549_HUMAN UPF0606 protein KIAA1549 OS=Homo sapiens OX=9606 GN=KIAA1549 PE=1 SV=4
11	PDB:4xd9A	0.013	0.082	4.756E-1	236	0.003	0.025	4xd9A.pdb.gz
12	PDB:7l08AD	0.025	0.101	8.494E-1	343	0.007	0.038	7l08AD.pdb.gz	Distinct mechanisms of the human mitoribosome recycling and antibiotic resistance.
13	PDB:7f5yB	0.017	0.186	1.031	120	0.003	0.050	7f5yB.pdb.gz
14	PDB:6l0aC	0.015	0.066	1.334	365	0.003	0.014	6l0aC.pdb.gz	Structural Analysis of Saccharomyces cerevisiae Dihydroorotase Reveals Molecular Insights into the Tetramerization Mechanism
15	PDB:1lqtB	0.013	0.049	1.618	454	0.002	0.007	1lqtB.pdb.gz	A covalent modification of NADP+ revealed by the atomic resolution structure of FprA, a Mycobacterium tuberculosis oxidoreductase.
16	PDB:4jchA	0.016	0.066	1.726	436	0.004	0.016	4jchA.pdb.gz	Structure of OSH4 bound to an electrophilic oxysterol
17	PDB:4dchA	0.015	0.055	2.094	434	0.001	0.005	4dchA.pdb.gz	Insights into Mechanism of Glucokinase Activation: OBSERVATION OF MULTIPLE DISTINCT PROTEIN CONFORMATIONS.
18	PDB:6rupA	0.019	0.218	2.094	111	0.004	0.072	6rupA.pdb.gz	Dominant mutations in mtDNA maintenance gene SSBP1 cause optic atrophy and foveopathy.
19	PDB:4v6wCX	0.017	0.151	2.382	120	0.008	0.125	4v6wCX.pdb.gz	Structures of the human and Drosophila 80S ribosome.
20	PDB:5gpkB	0.016	0.101	2.382	207	0.004	0.039	5gpkB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q68DN1	0.0	4012	1984	1.000	1.000	CB016_HUMAN Uncharacterized protein C2orf16 OS=Homo sapiens OX=9606 GN=C2orf16 PE=2 SV=3
2	Q8IXT5	1.53e-08	62.4	1001	0.036	0.072	RB12B_HUMAN RNA-binding protein 12B OS=Homo sapiens OX=9606 GN=RBM12B PE=1 SV=2
3	O97267	7.77e-04	47.4	2114	0.019	0.018	O97267_PLAF7 Circumsporozoite- and TRAP-related protein OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0315200 PE=4 SV=1
4	O13849	0.001	46.6	1002	0.019	0.037	CBPY_SCHPO Carboxypeptidase Y OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cpy1 PE=1 SV=1
5	Q54VJ6	0.003	45.1	462	0.012	0.052	Q54VJ6_DICDI Uncharacterized protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0280299 PE=4 SV=1
6	Q9VJ87	0.009	43.9	1330	0.037	0.055	CWC22_DROME Pre-mRNA-splicing factor CWC22 homolog OS=Drosophila melanogaster OX=7227 GN=ncm PE=1 SV=3
7	P18583	0.014	43.1	2426	0.021	0.017	SON_HUMAN Protein SON OS=Homo sapiens OX=9606 GN=SON PE=1 SV=4
8	Q9QX47	0.021	42.7	2444	0.021	0.017	SON_MOUSE Protein SON OS=Mus musculus OX=10090 GN=Son PE=1 SV=2
9	Q8IGV4	0.039	41.6	1002	0.025	0.049	Q8IGV4_DROME RE23622p (Fragment) OS=Drosophila melanogaster OX=7227 GN=Moca-cyp PE=2 SV=1
10	Q9VAW1	0.062	40.8	970	0.025	0.051	Q9VAW1_DROME Moca-cyp, isoform A OS=Drosophila melanogaster OX=7227 GN=Moca-cyp PE=1 SV=1
11	Q8ISE5	0.077	40.4	968	0.025	0.051	Q8ISE5_DROME Peptidylprolyl cis-trans isomerase OS=Drosophila melanogaster OX=7227 GN=Moca-cyp PE=2 SV=1
12	Q15878	0.12	40.0	2313	0.025	0.022	CAC1E_HUMAN Voltage-dependent R-type calcium channel subunit alpha-1E OS=Homo sapiens OX=9606 GN=CACNA1E PE=1 SV=3
13	H7C1M2	0.21	39.3	1454	0.025	0.034	H7C1M2_HUMAN SON DNA and RNA binding protein (Fragment) OS=Homo sapiens OX=9606 GN=SON PE=1 SV=1
14	Q07652	0.28	38.9	2222	0.018	0.016	CAC1E_RAT Voltage-dependent R-type calcium channel subunit alpha-1E OS=Rattus norvegicus OX=10116 GN=Cacna1e PE=1 SV=1
15	Q61290	0.31	38.9	2272	0.018	0.015	CAC1E_MOUSE Voltage-dependent R-type calcium channel subunit alpha-1E OS=Mus musculus OX=10090 GN=Cacna1e PE=1 SV=1
16	Q8IHF0	0.32	38.1	491	0.025	0.100	Q8IHF0_DROME AT07931p OS=Drosophila melanogaster OX=7227 GN=Moca-cyp PE=2 SV=1
17	Q57UP2	0.48	37.7	507	0.023	0.089	Q57UP2_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.5F10.460 PE=4 SV=1
18	Q8IFL9	0.94	37.0	1222	0.031	0.051	Q8IFL9_PLAF7 Serine/threonine protein kinase, FIKK family OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0424700 PE=4 SV=1
19	Q9VAW2	5.5	34.3	685	0.024	0.070	Q9VAW2_DROME GH23813p OS=Drosophila melanogaster OX=7227 GN=Moca-cyp PE=1 SV=2
20	Q86G45	9.6	33.9	2027	0.012	0.012	Q86G45_CAEEL EF-hand domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=unc-2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08017 Fibrinogen_BP	0.11	22.6	Fibrinogen binding protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000386190

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000347648	0.807	Zinc finger protein 512
2	9606.ENSP00000264703	0.772	Fibronectin type III domain-containing protein 4
3	9606.ENSP00000412150	0.688	Coiled-coil domain containing 121
4	9606.ENSP00000403181	0.600	Uncharacterized protein
5	9606.ENSP00000264718	0.556	GPN-loop GTPase 1
6	9606.ENSP00000264717	0.519	Glucokinase regulatory protein
7	9606.ENSP00000479964	0.519	Kanadaptin
8	9606.ENSP00000260210	0.504	BUD13 homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.976	biological regulation
GO:0050789	0.970	regulation of biological process
GO:0009987	0.963	cellular process
GO:0050794	0.776	regulation of cellular process
GO:0071704	0.586	organic substance metabolic process
GO:0044238	0.443	primary metabolic process
GO:0006807	0.380	nitrogen compound metabolic process
GO:0044237	0.375	cellular metabolic process
GO:0050896	0.300	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0070062	0.995	extracellular exosome
GO:0070013	0.939	intracellular organelle lumen
GO:0005654	0.921	nucleoplasm
GO:0005737	0.757	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]