StarFunc result for job id Q68DX3

User Input

>input (1309 residues)
MQPLTKDAGMSLSSVTLASALQVRGEALSEEEIWSLLFLAAEQLLEDLRNDSSDYVVCPW
SALLSAAGSLSFQGRVSHIEAAPFKAPELLQGQSEDEQPDASQMHVYSLGMTLYWSAGFH
VPPHQPLQLCEPLHSILLTMCEDQPHRRCTLQSVLEACRVHEKEVSVYPAPAGLHIRRLV
GLVLGTISEVEKRVVEESSSVQQNRSYLLRKRLRGTSSESPAAQAPECLHPCRVSERSTE
TQSSPEPHWSTLTHSHCSLLVNRALPGADPQDQQAGRRLSSGSVHSAADSSWPTTPSQRG
FLQRRSKFSRPEFILLAGEAPMTLHLPGSVVTKKGKSYLALRDLCVVLLNGQHLEVKCDV
ESTVGAVFNAVTSFANLEELTYFGLAYMKSKEFFFLDSETRLCKIAPEGWREQPQKTSMN
TFTLFLRIKFFVSHYGLLQHSLTRHQFYLQLRKDILEERLYCNEEILLQLGVLALQAEFG
NYPKEQVESKPYFHVEDYIPASLIERMTALRVQVEVSEMHRLSSALWGEDAELKFLRVTQ
QLPEYGVLVHQVFSEKRRPEEEMALGICAKGVIVYEVKNNSRIAMLRFQWRETGKISTYQ
KKFTITSSVTGKKHTFVTDSAKTSKYLLDLCSAQHGFNAQMGSGQPSHVLFDHDKFVQMA
NLSPAHQARSKPLIWIQRLSCSENELFVSRLQGAAGGLLSTSMDNFNVDGSKEAGAEGIG
RSPCTGREQLKSACVIQKPMTWDSLSGPPVQSMHAGSKNNRRKSFIAEPGREIVRVTLKR
DPHRGFGFVINEGEYSGQADPGIFISSIIPGGPAEKAKTIKPGGQILALNHISLEGFTFN
MAVRMIQNSPDNIELIISQSKGVGGNNPDEEKNSTANSGVSSTDILSFGYQGSLLSHTQD
QDRNTEELDMAGVQSLVPRLRHQLSFLPLKGAGSSCPPSPPEISAGEIYFVELVKEDGTL
GFSVTGGINTSVPYGGIYVKSIVPGGPAAKEGQILQGDRLLQVDGVILCGLTHKQAVQCL
TGPGQVARLVLERRVPRSTQQCPSANDSMGDERTAVSLVTALPGRPSSCVSVTDGPKFEV
KLKKNANGLGFSFVQMEKESCSHLKSDLVRIKRLFPGQPAEENGAIAAGDIILAVNGRST
EGLIFQEVLHLLRGAPQEVTLLLCRPPPGALPELEQEWQTPELSADKEFTRATCTDSCTS
PILDQEDSWRDSASPDAGEGLGLRPESSQKAIREAQWGQNRERPWASSLTHSPESHPHLC
KLHQERDESTLATSLEKDVRQNCYSVCDIMRLGRYSFSSPLTRLSTDIF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q68DX3	1.000	1.000	0.000	1309	1.000	1.000	Q68DX3.pdb.gz	FRPD2_HUMAN FERM and PDZ domain-containing protein 2 OS=Homo sapiens OX=9606 GN=FRMPD2 PE=1 SV=3
2	AFDB:F1LQQ5	0.217	0.275	9.280E-31	1018	0.113	0.145	F1LQQ5.pdb.gz	F1LQQ5_RAT Tyrosine-protein phosphatase non-receptor type OS=Rattus norvegicus OX=10116 GN=Ptpn3 PE=3 SV=2
3	AFDB:F1NMZ1	0.125	0.128	4.823E-26	1256	0.096	0.100	F1NMZ1.pdb.gz
4	AFDB:A0T1Z4	0.198	0.275	6.472E-21	932	0.134	0.189	A0T1Z4.pdb.gz	A0T1Z4_DROME Moesin/ezrin/radixin homolog 1 OS=Drosophila melanogaster OX=7227 GN=yrt PE=2 SV=1
5	AFDB:Q8N878	0.201	0.459	1.555E-18	549	0.078	0.186	Q8N878.pdb.gz	FRMD1_HUMAN FERM domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FRMD1 PE=1 SV=2
6	AFDB:Q8JG61	0.199	0.171	4.463E-18	1534	0.122	0.104	Q8JG61.pdb.gz	Q8JG61_DANRE Erythrocyte membrane protein band 4.1 (Elliptocytosis 1, RH-linked) OS=Danio rerio OX=7955 GN=epb41 PE=2 SV=1
7	PDB:4rm8A	0.205	0.670	7.804E-17	368	0.059	0.209	4rm8A.pdb.gz
8	AFDB:B8JHS0	0.202	0.316	1.055E-16	811	0.106	0.171	B8JHS0.pdb.gz
9	AFDB:Q17353	0.080	0.078	5.128E-16	1379	0.117	0.111	Q17353.pdb.gz	PAR3_CAEEL Partitioning defective protein 3 OS=Caenorhabditis elegans OX=6239 GN=par-3 PE=1 SV=1
10	PDB:2xkxA	0.077	0.125	6.775E-16	721	0.072	0.130	2xkxA.pdb.gz
11	AFDB:Q14CM0	0.196	0.194	1.878E-13	1322	0.116	0.115	Q14CM0.pdb.gz	FRPD4_HUMAN FERM and PDZ domain-containing protein 4 OS=Homo sapiens OX=9606 GN=FRMPD4 PE=1 SV=1
12	AFDB:D3ZW88	0.191	0.183	1.467E-12	1371	0.118	0.112	D3ZW88.pdb.gz	D3ZW88_RAT FERM and PDZ domain containing 1 OS=Rattus norvegicus OX=10116 GN=Frmpd1 PE=4 SV=3
13	PDB:7pc3A	0.069	0.220	2.698E-8	405	0.025	0.081	7pc3A.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
14	PDB:7c3mA	0.181	0.384	7.741E-8	577	0.038	0.087	7c3mA.pdb.gz
15	PDB:6r9tA	0.125	0.077	2.222E-7	2185	0.024	0.015	6r9tA.pdb.gz
16	PDB:7p73A	0.069	0.212	2.469E-7	420	0.022	0.069	7p73A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
17	PDB:7qqmA	0.068	0.209	1.482E-6	413	0.024	0.075	7qqmA.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
18	PDB:6t36A	0.065	0.858	4.482E-6	93	0.017	0.237	6t36A.pdb.gz	Molecular basis of the interaction of the human tyrosine phosphatase PTPN3 with the hepatitis B virus core protein.
19	PDB:5n7dA	0.064	0.192	5.534E-6	423	0.021	0.064	5n7dA.pdb.gz	Dynamic control of RSK complexes by phosphoswitch-based regulation.
20	PDB:7p70A	0.062	0.197	6.833E-6	407	0.021	0.066	7p70A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q68DX3	0.0	2698	1309	1.000	1.000	FRPD2_HUMAN FERM and PDZ domain-containing protein 2 OS=Homo sapiens OX=9606 GN=FRMPD2 PE=1 SV=3
2	Q6EHH9	3.36e-80	294	2500	0.118	0.062	Q6EHH9_XENLA Frizzled-8 associated multidomain protein (Fragment) OS=Xenopus laevis OX=8355 GN=FRIED PE=1 SV=1
3	Q12923	5.11e-80	293	2485	0.121	0.064	PTN13_HUMAN Tyrosine-protein phosphatase non-receptor type 13 OS=Homo sapiens OX=9606 GN=PTPN13 PE=1 SV=2
4	A0A8I6A6L8	2.47e-77	285	2266	0.121	0.070	A0A8I6A6L8_RAT Tyrosine-protein phosphatase non-receptor type 13 OS=Rattus norvegicus OX=10116 GN=Ptpn13 PE=3 SV=1
5	G3V9S3	4.38e-77	284	2460	0.120	0.064	G3V9S3_RAT Tyrosine-protein phosphatase non-receptor type 13 OS=Rattus norvegicus OX=10116 GN=Ptpn13 PE=1 SV=2
6	A0A0G2K1K1	4.63e-77	284	2445	0.118	0.063	A0A0G2K1K1_RAT Tyrosine-protein phosphatase non-receptor type 13 OS=Rattus norvegicus OX=10116 GN=Ptpn13 PE=1 SV=1
7	A0A8I5ZZK7	5.37e-77	284	2273	0.120	0.069	A0A8I5ZZK7_RAT Tyrosine-protein phosphatase non-receptor type 13 OS=Rattus norvegicus OX=10116 GN=Ptpn13 PE=3 SV=1
8	Q64512	2.39e-75	279	2453	0.119	0.064	PTN13_MOUSE Tyrosine-protein phosphatase non-receptor type 13 OS=Mus musculus OX=10090 GN=Ptpn13 PE=1 SV=2
9	Q16825	1.24e-27	124	1174	0.067	0.075	PTN21_HUMAN Tyrosine-protein phosphatase non-receptor type 21 OS=Homo sapiens OX=9606 GN=PTPN21 PE=1 SV=2
10	Q8C0V9	1.70e-27	122	622	0.055	0.116	FRMD6_MOUSE FERM domain-containing protein 6 OS=Mus musculus OX=10090 GN=Frmd6 PE=1 SV=2
11	Q96NE9	3.13e-27	121	622	0.056	0.117	FRMD6_HUMAN FERM domain-containing protein 6 OS=Homo sapiens OX=9606 GN=FRMD6 PE=1 SV=1
12	Q62728	1.88e-26	120	1175	0.069	0.077	PTN21_RAT Tyrosine-protein phosphatase non-receptor type 21 OS=Rattus norvegicus OX=10116 GN=Ptpn21 PE=1 SV=1
13	Q15678	3.11e-25	116	1187	0.069	0.076	PTN14_HUMAN Tyrosine-protein phosphatase non-receptor type 14 OS=Homo sapiens OX=9606 GN=PTPN14 PE=1 SV=2
14	Q62130	5.99e-25	115	1189	0.069	0.076	PTN14_MOUSE Tyrosine-protein phosphatase non-receptor type 14 OS=Mus musculus OX=10090 GN=Ptpn14 PE=1 SV=2
15	A0A286YBL8	7.47e-24	112	1204	0.065	0.071	A0A286YBL8_DANRE protein-tyrosine-phosphatase OS=Danio rerio OX=7955 GN=ptpn21 PE=3 SV=1
16	F1Q6T9	9.05e-24	111	1168	0.065	0.073	F1Q6T9_DANRE Tyrosine-protein phosphatase non-receptor type OS=Danio rerio OX=7955 GN=ptpn21 PE=3 SV=2
17	Q9V8R9	3.87e-21	103	1698	0.058	0.045	EPB41_DROME Protein 4.1 homolog OS=Drosophila melanogaster OX=7227 GN=cora PE=1 SV=1
18	Q9Y2J2	4.09e-21	102	1087	0.066	0.079	E41L3_HUMAN Band 4.1-like protein 3 OS=Homo sapiens OX=9606 GN=EPB41L3 PE=1 SV=2
19	Q8N878	1.39e-20	99.8	549	0.046	0.109	FRMD1_HUMAN FERM domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FRMD1 PE=1 SV=2
20	F1MAD2	1.91e-20	100	1836	0.074	0.053	INADL_RAT InaD-like protein OS=Rattus norvegicus OX=10116 GN=Patj PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19805 DUF6288	4.9e+02	11.2	Family of unknown function (DUF6288)
2	PF09380 FERM_C	8.3e-16	69.5	FERM C-terminal PH-like domain
3	PF00373 FERM_M	3.4e-20	84.0	FERM central domain
4	PF09379 FERM_N	6.5e-14	62.9	FERM N-terminal domain
5	PF00595 PDZ	2.3e-40	148.1	PDZ domain
6	PF13180 PDZ_2	1.3e-10	52.8	PDZ domain
7	PF17820 PDZ_6	1.3e-22	90.7	PDZ domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000363317

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000374409	0.767	Plakophilin-4
2	9606.ENSP00000300589	0.750	Nucleotide-binding oligomerization domain-containing protein 2
3	9606.ENSP00000263207	0.736	Armadillo repeat protein deleted in velo-cardio-facial syndrome
4	9606.ENSP00000307134	0.734	Catenin delta-2
5	9606.ENSP00000361177	0.691	Leucine-rich repeat, immunoglobulin-like domain and transmembrane domain-containing protein 1
6	9606.ENSP00000304437	0.651	Protein very KIND
7	9606.ENSP00000359698	0.650	Ubiquitin domain-containing protein 1
8	9606.ENSP00000358251	0.637	Protein FAM160B1
9	9606.ENSP00000367494	0.632	Protein spire homolog 2
10	9606.ENSP00000363459	0.612	Tyrosine-protein phosphatase non-receptor type 20
11	9606.ENSP00000382004	0.610	Catenin delta-1
12	9606.ENSP00000344393	0.603	rRNA-processing protein FCF1 homolog
13	9606.ENSP00000412461	0.594	Rho GTPase-activating protein 22
14	9606.ENSP00000299163	0.590	Hypoxia-inducible factor 1-alpha inhibitor
15	9606.ENSP00000379818	0.539	Glutamate receptor ionotropic, NMDA 2A
16	9606.ENSP00000331065	0.531	Protein phosphatase 1 regulatory subunit 27
17	9606.ENSP00000246151	0.517	Promotes megakaryocyte differentiation by up-regulating RUNX1 expression . Regulates RUNX1 expression by activating the proximal promoter of the RUNX1 gene and by enhancing the translation activity of an internal ribosome entry site (IRES) element in the RUNX1 gene
18	9606.ENSP00000351619	0.508	Phenazine biosynthesis like protein domain containing

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005545	1.000	1-phosphatidylinositol binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.988	cellular process
GO:0016043	0.975	cellular component organization
GO:0034330	0.836	cell junction organization
GO:0050789	0.816	regulation of biological process
GO:0050794	0.788	regulation of cellular process
GO:0022607	0.778	cellular component assembly
GO:0045216	0.777	cell-cell junction organization
GO:0034329	0.722	cell junction assembly
GO:0007043	0.691	cell-cell junction assembly
GO:0120193	0.664	tight junction organization
GO:0120192	0.617	tight junction assembly
GO:0050896	0.313	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.998	plasma membrane
GO:0030054	0.990	cell junction
GO:0070161	0.979	anchoring junction
GO:0005911	0.939	cell-cell junction
GO:0005622	0.928	intracellular anatomical structure
GO:0043226	0.819	organelle
GO:0005737	0.817	cytoplasm
GO:0043229	0.768	intracellular organelle
GO:0098590	0.675	plasma membrane region
GO:0043296	0.514	apical junction complex
GO:0045178	0.457	basal part of cell
GO:0009925	0.435	basal plasma membrane
GO:0070160	0.409	tight junction
GO:0016323	0.409	basolateral plasma membrane
GO:0043227	0.400	membrane-bounded organelle
GO:0005923	0.390	bicellular tight junction
GO:0043231	0.385	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]