StarFunc result for job id Q68E01

User Input

>input (1043 residues)
MELQKGKGAAAAAAASGAAGGGGGGAGAGAPGGGRLLLSTSLDAKDELEERLERCMSIVT
SMTAGVSEREANDALNAYVCKGLPQHEEICLGLFTLILTEPAQAQKCYRDLALVSRDGMN
IVLNKINQILMEKYLKLQDTCRTQLVWLVRELVKSGVLGADGVCMTFMKQIAGGGDVTAK
NIWLAESVLDILTEQREWVLKSSILIAMAVYTYLRLIVDHHGTAQLQALRQKEVDFCISL
LRERFMECLMIGRDLVRLLQNVARIPEFELLWKDIIHNPQALSPQFTGILQLLQSRTSRK
FLACRLTPDMETKLLFMTSRVRFGQQKRYQDWFQRQYLSTPDSQSLRCDLIRYICGVVHP
SNEVLSSDILPRWAIIGWLLTTCTSNVAASNAKLALFYDWLFFSPDKDSIMNIEPAILVM
HHSMKPHPAITATLLDFMCRIIPNFYPPLEGHVRQGVFSSLNHIVEKRVLAHLAPLFDNP
KLDKELRAMLREKFPEFCSSPSPPVEVKIEEPVSMEMDNHMSDKDESCYDNAEAAFSDDE
EDLNSKGKKREFRFHPIKETVVEEPVDITPYLDQLDESLRDKVLQLQKGSDTEAQCEVMQ
EIVDQVLEEDFDSEQLSVLASCLQELFKAHFRGEVLPEEITEESLEESVGKPLYLIFRNL
CQMQEDNSSFSLLLDLLSELYQKQPKIGYHLLYYLRASKAAAGKMNLYESFAQATQLGDL
HTCLMMDMKACQEDDVRLLCHLTPSIYTEFPDETLRSGELLNMIVAVIDSAQLQELVCHV
MMGNLVMFRKDSVLNILIQSLDWETFEQYCAWQLFLAHNIPLETIIPILQHLKYKEHPEA
LSCLLLQLRREKPSEEMVKMVLSRPCHPDDQFTTSILRHWCMKHDELLAEHIKSLLIKNN
SLPRKRQSLRSSSSKLAQLTLEQILEHLDNLRLNLTNTKQNFFSQTPILQALQHVQASCD
EAHKMKFSDLFSLAEEYEDSSTKPPKSRRKAALSSPRSRKNATQPPNAEEESGSSSASEE
EDTKPKPTKRKRKGSSAVGSDSD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q68E01	1.000	1.000	0.000	1043	1.000	1.000	Q68E01.pdb.gz	INT3_HUMAN Integrator complex subunit 3 OS=Homo sapiens OX=9606 GN=INTS3 PE=1 SV=1
2	AFDB:Q7PLS8	0.458	0.448	1.093E-59	1068	0.377	0.368	Q7PLS8.pdb.gz	INT3_DROME Integrator complex subunit 3 OS=Drosophila melanogaster OX=7227 GN=IntS3 PE=1 SV=1
3	AFDB:Q583M5	0.146	0.109	3.404E-7	1621	0.138	0.089	Q583M5.pdb.gz	Q583M5_TRYB2 TOG domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.5F5.840 PE=3 SV=1
4	AFDB:Q583W5	0.125	0.081	1.188E-5	2070	0.134	0.068	Q583W5.pdb.gz	Q583W5_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.2H8.1110 PE=3 SV=1
5	AFDB:Q99M76	0.217	0.193	1.422E-5	1256	0.140	0.116	Q99M76.pdb.gz	STAG3_RAT Cohesin subunit SA-3 OS=Rattus norvegicus OX=10116 GN=Stag3 PE=2 SV=1
6	AFDB:Q9VAJ1	0.171	0.142	1.764E-5	1380	0.128	0.097	Q9VAJ1.pdb.gz	Q9VAJ1_DROME Condensin complex subunit 1 OS=Drosophila melanogaster OX=7227 GN=Cap-D2 PE=1 SV=1
7	PDB:6ahoA	0.138	0.153	2.176E-5	916	0.099	0.112	6ahoA.pdb.gz
8	PDB:6n1zA	0.145	0.155	2.255E-5	961	0.114	0.124	6n1zA.pdb.gz
9	AFDB:Q06680	0.124	0.125	3.021E-5	1035	0.129	0.130	Q06680.pdb.gz	CND3_YEAST Condensin complex subunit 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YCG1 PE=1 SV=2
10	PDB:4jlqA	0.140	0.167	5.734E-5	840	0.105	0.130	4jlqA.pdb.gz	Crystal structure of human Karyopherin beta 2 bound to the PY-NLS of Saccharomyces cerevisiae Nab2.
11	PDB:7wttK	0.160	0.161	7.920E-5	1022	0.111	0.114	7wttK.pdb.gz	The nucleoplasmic phase of pre-40S formation prior to nuclear export.
12	PDB:6xu2A	0.131	0.127	8.210E-5	1091	0.112	0.107	6xu2A.pdb.gz	X-ray Structure of the Human Karyopherin RanBP5, an Essential Factor for Influenza Polymerase Nuclear Trafficking.
13	PDB:5gm6G	0.149	0.169	1.055E-4	875	0.112	0.134	5gm6G.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
14	PDB:4bujB	0.107	0.093	1.175E-4	1367	0.100	0.076	4bujB.pdb.gz
15	PDB:4a0cA	0.119	0.109	1.406E-4	1155	0.123	0.111	4a0cA.pdb.gz	The Molecular Basis of Crl4(Ddb2/Csa) Ubiquitin Ligase Architecture, Targeting, and Activation
16	PDB:6qnxA	0.195	0.209	1.566E-4	928	0.095	0.107	6qnxA.pdb.gz	The structural basis for cohesin-CTCF-anchored loops.
17	PDB:7zf1B	0.147	0.138	1.943E-4	1179	0.127	0.112	7zf1B.pdb.gz
18	AFDB:Q62018	0.108	0.100	2.796E-4	1173	0.128	0.114	Q62018.pdb.gz	CTR9_MOUSE RNA polymerase-associated protein CTR9 homolog OS=Mus musculus OX=10090 GN=Ctr9 PE=1 SV=2
19	AFDB:F1QJY8	0.130	0.133	3.345E-4	1003	0.123	0.128	F1QJY8.pdb.gz	F1QJY8_DANRE Condensin complex subunit 3 OS=Danio rerio OX=7955 GN=im:7149538 PE=1 SV=1
20	AFDB:P89105	0.111	0.109	5.940E-4	1077	0.133	0.129	P89105.pdb.gz	CTR9_YEAST RNA polymerase-associated protein CTR9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CTR9 PE=1 SV=3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q68E01	0.0	2157	1043	1.000	1.000	INT3_HUMAN Integrator complex subunit 3 OS=Homo sapiens OX=9606 GN=INTS3 PE=1 SV=1
2	Q7PLS8	1.46e-176	546	1068	0.242	0.236	INT3_DROME Integrator complex subunit 3 OS=Drosophila melanogaster OX=7227 GN=IntS3 PE=1 SV=1
3	Q5JVZ5	1.2	35.4	718	0.025	0.036	Q5JVZ5_HUMAN Engulfment and cell motility 2 OS=Homo sapiens OX=9606 GN=ELMO2 PE=1 SV=1
4	Q96JJ3	1.3	35.4	720	0.025	0.036	ELMO2_HUMAN Engulfment and cell motility protein 2 OS=Homo sapiens OX=9606 GN=ELMO2 PE=1 SV=2
5	Q5JVZ4	1.5	35.0	338	0.025	0.077	Q5JVZ4_HUMAN Engulfment and cell motility 2 (Fragment) OS=Homo sapiens OX=9606 GN=ELMO2 PE=1 SV=1
6	B2BUF1	8.4	32.0	230	0.021	0.096	B2BUF1_9INFA Non-structural protein 1 OS=Influenza A virus (A/Wyoming/03/2003(H3N2)) OX=480024 GN=NS1 PE=1 SV=1
7	Q86UK0	8.8	32.7	2595	0.034	0.013	ABCAC_HUMAN Glucosylceramide transporter ABCA12 OS=Homo sapiens OX=9606 GN=ABCA12 PE=1 SV=3
8	Q80U93	9.9	32.7	2085	0.026	0.013	NU214_MOUSE Nuclear pore complex protein Nup214 OS=Mus musculus OX=10090 GN=Nup214 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10189 Ints3_N	1.9e-182	618.3	Integrator complex subunit 3 N-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000019096

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000008846	0.988	Nucleic acid binding protein 2
2	9593.ENSGGOP00000007632	0.980	INTS3 and NABP interacting protein
3	9593.ENSGGOP00000001784	0.943	Nucleic acid binding protein 1
4	9593.ENSGGOP00000001500	0.942	Uncharacterized protein
5	9593.ENSGGOP00000019801	0.930	Integrator complex subunit 10
6	9593.ENSGGOP00000020350	0.924	Integrator complex subunit 1
7	9593.ENSGGOP00000001162	0.921	Integrator complex subunit 6
8	9593.ENSGGOP00000005260	0.894	Integrator complex subunit 11
9	9593.ENSGGOP00000013166	0.884	Integrator complex subunit 12
10	9593.ENSGGOP00000016603	0.882	Integrator complex subunit 9
11	9593.ENSGGOP00000011845	0.881	Integrator complex subunit 7
12	9593.ENSGGOP00000019388	0.872	Integrator complex subunit 5
13	9593.ENSGGOP00000025545	0.871	Integrator complex subunit 2
14	9593.ENSGGOP00000011546	0.870	Integrator complex subunit 13
15	9593.ENSGGOP00000022743	0.870	Integrator complex subunit 14
16	9593.ENSGGOP00000005319	0.835	Integrator complex subunit 8
17	9593.ENSGGOP00000014450	0.808	DNA-directed RNA polymerase subunit
18	9593.ENSGGOP00000003857	0.804	Uncharacterized protein
19	9593.ENSGGOP00000019914	0.804	Uncharacterized protein
20	9593.ENSGGOP00000022958	0.797	RNA polymerase II associated protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044238	0.990	primary metabolic process
GO:0044237	0.990	cellular metabolic process
GO:0006807	0.988	nitrogen compound metabolic process
GO:0043170	0.987	macromolecule metabolic process
GO:0050794	0.983	regulation of cellular process
GO:0016073	0.975	snRNA metabolic process
GO:0033554	0.956	cellular response to stress
GO:0051726	0.955	regulation of cell cycle
GO:0006974	0.953	cellular response to DNA damage stimulus
GO:0010467	0.940	gene expression
GO:1901987	0.900	regulation of cell cycle phase transition
GO:0007346	0.899	regulation of mitotic cell cycle
GO:1903047	0.896	mitotic cell cycle process
GO:0000075	0.884	cell cycle checkpoint signaling
GO:1901990	0.850	regulation of mitotic cell cycle phase transition
GO:0006396	0.846	RNA processing
GO:0044260	0.844	cellular macromolecule metabolic process
GO:0007093	0.810	mitotic cell cycle checkpoint signaling
GO:1902749	0.796	regulation of cell cycle G2/M phase transition
GO:0010389	0.793	regulation of G2/M transition of mitotic cell cycle
GO:1901991	0.743	negative regulation of mitotic cell cycle phase transition
GO:0034470	0.742	ncRNA processing
GO:1902750	0.721	negative regulation of cell cycle G2/M phase transition
GO:0044818	0.714	mitotic G2/M transition checkpoint
GO:0016180	0.705	snRNA processing
GO:0006259	0.700	DNA metabolic process
GO:0006281	0.682	DNA repair
GO:0009314	0.480	response to radiation
GO:0006302	0.461	double-strand break repair
GO:0006310	0.414	DNA recombination
GO:0010212	0.412	response to ionizing radiation
GO:0019222	0.352	regulation of metabolic process
GO:0051171	0.342	regulation of nitrogen compound metabolic process
GO:0000724	0.329	double-strand break repair via homologous recombination

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0140513	1.000	nuclear protein-containing complex
GO:0005654	1.000	nucleoplasm
GO:0005694	0.998	chromosome
GO:0090734	0.991	site of DNA damage
GO:0035861	0.983	site of double-strand break
GO:0070876	0.729	SOSS complex
GO:0032039	0.676	integrator complex
GO:0016020	0.547	membrane
GO:0005829	0.464	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]