StarFunc result for job id Q69YI7

User Input

>input (327 residues)
MAVPAKKRKMNFSEREVEIIVEELELKKHLLVNHFNAGVPLAAKSAAWHGILRRVNAVAT
CRRELPEVKKKWSDLKTEVRRKVAQVRAAVEGGEAPGPTEEDGAGGPGTGGGSGGGGPAV
APVLLTPMQQRICNLLGEATIISLPSTTEIHPVALGPSATAAAATVTLTQIPTETTYHTL
EEGVVEYCTAEAPPPLPPETPVDMMAQHADTSVKPQALKSRIALNSAKLIQEQRVTNLHV
KEIAQHLEQQNDLLQMIRRSQEVQACAQERQAQAMEGTQAALSVLIQVLRPMIKDFRRYL
QSNTANPAPASDPGQVAQNGQPDSIIQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R887	0.490	0.490	4.407E-41	327	1.000	1.000	A0A024R887.pdb.gz
2	AFDB:Q8NCY6	0.271	0.258	1.582E-5	345	0.165	0.157	Q8NCY6.pdb.gz	MSD4_HUMAN Myb/SANT-like DNA-binding domain-containing protein 4 OS=Homo sapiens OX=9606 GN=MSANTD4 PE=1 SV=1
3	AFDB:Q8R4U1	0.284	0.238	1.783E-5	393	0.235	0.196	Q8R4U1.pdb.gz	MYPOP_MOUSE Myb-related transcription factor, partner of profilin OS=Mus musculus OX=10090 GN=Mypop PE=1 SV=1
4	AFDB:Q86VE0	0.288	0.238	2.711E-5	399	0.223	0.183	Q86VE0.pdb.gz	MYPOP_HUMAN Myb-related transcription factor, partner of profilin OS=Homo sapiens OX=9606 GN=MYPOP PE=1 SV=2
5	AFDB:A0AVG3	0.309	0.202	4.375E-5	514	0.162	0.103	A0AVG3.pdb.gz	A0AVG3_HUMAN t-SNARE domain containing 1 OS=Homo sapiens OX=9606 GN=TSNARE1 PE=1 SV=1
6	AFDB:Q8L727	0.255	0.151	7.083E-3	591	0.138	0.076	Q8L727.pdb.gz	GSTT2_ARATH Glutathione S-transferase T2 OS=Arabidopsis thaliana OX=3702 GN=GSTT2 PE=2 SV=1
7	AFDB:O80512	0.195	0.173	9.554E-3	372	0.150	0.132	O80512.pdb.gz	O80512_ARATH Alcohol dehydrogenase transcription factor Myb/SANT-like family protein OS=Arabidopsis thaliana OX=3702 GN=At2g44730 PE=1 SV=1
8	AFDB:Q9ZQN7	0.244	0.236	1.077E-2	340	0.168	0.162	Q9ZQN7.pdb.gz	Q9ZQN7_ARATH Homeodomain-like superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At2g35640 PE=4 SV=1
9	AFDB:A0A0B4KGD0	0.309	0.209	1.637E-2	499	0.128	0.084	A0A0B4KGD0.pdb.gz	A0A0B4KGD0_DROME Regulatory protein zeste OS=Drosophila melanogaster OX=7227 GN=apt PE=1 SV=1
10	AFDB:Q6J1H4	0.215	0.208	3.162E-2	339	0.165	0.159	Q6J1H4.pdb.gz	UTF1_MOUSE Undifferentiated embryonic cell transcription factor 1 OS=Mus musculus OX=10090 GN=Utf1 PE=1 SV=2
11	PDB:1no4A	0.098	0.358	6.096	77	0.034	0.143	1no4A.pdb.gz
12	PDB:1ykbD	0.095	0.152	6.096	142	0.034	0.077	1ykbD.pdb.gz	Structure of insect-cell-derived IL-22.
13	PDB:3ejbA	0.112	0.378	6.096	78	0.034	0.141	3ejbA.pdb.gz	Structural insights from a P450 Carrier Protein complex reveal how specificity is achieved in the P450(BioI) ACP complex.
14	PDB:7vkkA	0.067	0.075	6.472	287	0.040	0.045	7vkkA.pdb.gz
15	PDB:7wffh	0.106	0.184	6.871	145	0.031	0.069	7wffh.pdb.gz	Supramolecular assembly of chloroplast NADH dehydrogenase-like complex with photosystem I from Arabidopsis thaliana.
16	PDB:6h5eB	0.062	0.054	7.295	394	0.028	0.023	6h5eB.pdb.gz	Structural basis of cell wall peptidoglycan amidation by the GatD/MurT complex of Staphylococcus aureus.
17	PDB:7yp9D	0.104	0.031	7.295	1285	0.040	0.010	7yp9D.pdb.gz	Structural basis for intrinsic transcription termination.
18	PDB:4v6wAN	0.113	0.200	7.745	150	0.031	0.067	4v6wAN.pdb.gz	Structures of the human and Drosophila 80S ribosome.
19	PDB:2y6xA	0.096	0.236	8.223	109	0.028	0.083	2y6xA.pdb.gz
20	PDB:4lgwA	0.071	0.088	8.223	238	0.034	0.046	4lgwA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q69YI7	0.0	665	327	1.000	1.000	NAIF1_HUMAN Nuclear apoptosis-inducing factor 1 OS=Homo sapiens OX=9606 GN=NAIF1 PE=1 SV=1
2	A0AVG3	3.29e-12	69.3	514	0.159	0.101	A0AVG3_HUMAN t-SNARE domain containing 1 OS=Homo sapiens OX=9606 GN=TSNARE1 PE=1 SV=1
3	Q8R4U1	2.31e-06	51.2	393	0.086	0.071	MYPOP_MOUSE Myb-related transcription factor, partner of profilin OS=Mus musculus OX=10090 GN=Mypop PE=1 SV=1
4	Q8NCY6	0.082	37.0	345	0.089	0.084	MSD4_HUMAN Myb/SANT-like DNA-binding domain-containing protein 4 OS=Homo sapiens OX=9606 GN=MSANTD4 PE=1 SV=1
5	P38989	3.8	32.0	1170	0.064	0.018	SMC2_YEAST Structural maintenance of chromosomes protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SMC2 PE=1 SV=1
6	Q6FLW1	7.2	31.2	1075	0.046	0.014	Q6FLW1_CANGA Candida glabrata strain CBS138 chromosome K complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0K13024g PE=4 SV=1
7	Q8IAS4	8.5	30.8	2231	0.046	0.007	Q8IAS4_PLAF7 Erythrocyte membrane protein 1, PfEMP1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0808700 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10545 MADF_DNA_bdg	1.7	20.4	Alcohol dehydrogenase transcription factor Myb/SANT-like
2	PF13873 Myb_DNA-bind_5	5.9e-22	88.7	Myb/SANT-like DNA-binding domain
3	PF10461 Peptidase_S68	1.7e+02	14.0	Peptidase S68

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000362170

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000317743	0.919	Putative nuclease HARBI1
2	9606.ENSP00000423630	0.770	F-box/LRR-repeat protein 7
3	9606.ENSP00000285873	0.766	Gem-associated protein 5
4	9606.ENSP00000420405	0.763	Fibrinogen silencer-binding protein
5	9606.ENSP00000357305	0.748	GTP-binding protein Rit1
6	9606.ENSP00000366902	0.747	Telomere zinc finger-associated protein
7	9606.ENSP00000368761	0.741	Zinc finger protein 827
8	9606.ENSP00000415836	0.734	Zinc finger protein 276
9	9606.ENSP00000303580	0.732	NF-kappa-B inhibitor-interacting Ras-like protein 2
10	9606.ENSP00000386710	0.726	Autophagy-related protein 9A
11	9606.ENSP00000358576	0.715	5' exonuclease Apollo
12	9606.ENSP00000389715	0.714	Kinase suppressor of Ras 2
13	9606.ENSP00000262811	0.694	Microtubule associated serine/threonine kinase 3
14	9606.ENSP00000362702	0.687	Serine/threonine-protein kinase Nek6
15	9606.ENSP00000263736	0.684	S1 RNA-binding domain-containing protein 1
16	9606.ENSP00000305343	0.676	Transcription factor SOX-14
17	9606.ENSP00000276603	0.666	Telomeric repeat-binding factor 1
18	9606.ENSP00000318804	0.665	Cytokine receptor-like factor 3
19	9606.ENSP00000455426	0.660	Zinc finger protein 423
20	9606.ENSP00000228820	0.652	Poly [ADP-ribose] polymerase 11

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003676	0.976	nucleic acid binding
GO:0003677	0.827	DNA binding
GO:0043565	0.671	sequence-specific DNA binding
GO:0042802	0.616	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.986	regulation of cellular process
GO:0009987	0.982	cellular process
GO:0090559	0.977	regulation of membrane permeability
GO:0016043	0.974	cellular component organization
GO:0061024	0.960	membrane organization
GO:0007006	0.946	mitochondrial membrane organization
GO:0048523	0.943	negative regulation of cellular process
GO:0051179	0.941	localization
GO:0006915	0.823	apoptotic process
GO:0006839	0.701	mitochondrial transport
GO:0008637	0.701	apoptotic mitochondrial changes
GO:0046902	0.687	regulation of mitochondrial membrane permeability
GO:0051128	0.644	regulation of cellular component organization
GO:0051171	0.531	regulation of nitrogen compound metabolic process
GO:0040008	0.528	regulation of growth
GO:0031323	0.526	regulation of cellular metabolic process
GO:0080090	0.524	regulation of primary metabolic process
GO:0060255	0.521	regulation of macromolecule metabolic process
GO:0019219	0.489	regulation of nucleobase-containing compound metabolic process
GO:0010468	0.485	regulation of gene expression
GO:0031326	0.443	regulation of cellular biosynthetic process
GO:0010556	0.438	regulation of macromolecule biosynthetic process
GO:0001558	0.385	regulation of cell growth
GO:0045926	0.384	negative regulation of growth
GO:0048518	0.375	positive regulation of biological process
GO:0030308	0.371	negative regulation of cell growth
GO:0008152	0.341	metabolic process
GO:0048522	0.325	positive regulation of cellular process
GO:0051252	0.324	regulation of RNA metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	1.000	nucleoplasm
GO:0005886	0.999	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]