StarFunc result for job id Q69YN4

User Input

>input (1812 residues)
MAVDSAMELLFLDTFKHPSAEQSSHIDVVRFPCVVYINEVRVIPPGVRAHSSLPDNRAYG
ETSPHTFQLDLFFNNVSKPSAPVFDRLGSLEYDENTSIIFRPNSKVNTDGLVLRGWYNCL
TLAIYGSVDRVISHDRDSPPPPPPPPPPPQPQPSLKRNPKHADGEKEDQFNGSPPRPQPR
GPRTPPGPPPPDDDEDDPVPLPVSGDKEEDAPHREDYFEPISPDRNSVPQEGQYSDEGEV
EEEQQEEGEEDEDDVDVEEEEDEDEDDRRTVDSIPEEEEEDEEEEGEEDEEGEGDDGYEQ
ISSDEDGIADLERETFKYPNFDVEYTAEDLASVPPMTYDPYDRELVPLLYFSCPYKTTFE
IEISRMKDQGPDKENSGAIEASVKLTELLDLYREDRGAKWVTALEEIPSLIIKGLSYLQL
KNTKQDSLGQLVDWTMQALNLQVALRQPIALNVRQLKAGTKLVSSLAECGAQGVTGLLQA
GVISGLFELLFADHVSSSLKLNAFKALDSVISMTEGMEAFLRGRQNEKSGYQKLLELILL
DQTVRVVTAGSAILQKCHFYEVLSEIKRLGDHLAEKTSSLPNHSEPDHDTDAGLERTNPE
YENEVEASMDMDLLESSNISEGEIERLINLLEEVFHLMETAPHTMIQQPVKSFPTMARIT
GPPERDDPYPVLFRYLHSHHFLELVTLLLSIPVTSAHPGVLQATKDVLKFLAQSQKGLLF
FMSEYEATNLLIRALCHFYDQDEEEGLQSDGVIDDAFALWLQDSTQTLQCITELFSHFQR
CTASEETDHSDLLGTLHNLYLITFNPVGRSAVGHVFSLEKNLQSLITLMEYYSKEALGDS
KSKKSVAYNYACILILVVVQSSSDVQMLEQHAASLLKLCKADENNAKLQELGKWLEPLKN
LRFEINCIPNLIEYVKQNIDNLMTPEGVGLTTALRVLCNVACPPPPVEGQQKDLKWNLAV
IQLFSAEGMDTFIRVLQKLNSILTQPWRLHVNMGTTLHRVTTISMARCTLTLLKTMLTEL
LRGGSFEFKDMRVPSALVTLHMLLCSIPLSGRLDSDEQKIQNDIIDILLTFTQGVNEKLT
ISEETLANNTWSLMLKEVLSSILKVPEGFFSGLILLSELLPLPLPMQTTQVIEPHDISVA
LNTRKLWSMHLHVQAKLLQEIVRSFSGTTCQPIQHMLRRICVQLCDLASPTALLIMRTVL
DLIVEDLQSTSEDKEKQYTSQTTRLLALLDALASHKACKLAILHLINGTIKGDERYAEIF
QDLLALVRSPGDSVIRQQCVEYVTSILQSLCDQDIALILPSSSEGSISELEQLSNSLPNK
ELMTSICDCLLATLANSESSYNCLLTCVRTMMFLAEHDYGLFHLKSSLRKNSSALHSLLK
RVVSTFSKDTGELASSFLEFMRQILNSDTIGCCGDDNGLMEVEGAHTSRTMSINAAELKQ
LLQSKEESPENLFLELEKLVLEHSKDDDNLDSLLDSVVGLKQMLESSGDPLPLSDQDVEP
VLSAPESLQNLFNNRTAYVLADVMDDQLKSMWFTPFQAEEIDTDLDLVKVDLIELSEKCC
SDFDLHSELERSFLSEPSSPGRTKTTKGFKLGKHKHETFITSSGKSEYIEPAKRAHVVPP
PRGRGRGGFGQGIRPHDIFRQRKQNTSRPPSMHVDDFVAAESKEVVPQDGIPPPKRPLKV
SQKISSRGGFSGNRGGRGAFHSQNRFFTPPASKGNYSRREGTRGSSWSAQNTPRGNYNES
RGGQSNFNRGPLPPLRPLSSTGYRPSPRDRASRGRGGLGPSWASANSGSGGSRGKFVSGG
SGRGRHVRSFTR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7vf2A	0.636	0.954	0.000	1196	0.659	0.999	7vf2A.pdb.gz
2	AFDB:Q69YN4	1.000	1.000	0.000	1812	1.000	1.000	Q69YN4.pdb.gz	VIR_HUMAN Protein virilizer homolog OS=Homo sapiens OX=9606 GN=VIRMA PE=1 SV=2
3	AFDB:Q9W1R5	0.533	0.522	9.843E-55	1854	0.242	0.237	Q9W1R5.pdb.gz	VIR_DROME Protein virilizer OS=Drosophila melanogaster OX=7227 GN=vir PE=1 SV=1
4	AFDB:E1C2U2	0.114	0.095	6.340E-8	2326	0.106	0.083	E1C2U2.pdb.gz	RIF1_CHICK Telomere-associated protein RIF1 OS=Gallus gallus OX=9031 GN=RIF1 PE=3 SV=3
5	AFDB:Q5UIP0	0.111	0.086	5.443E-7	2472	0.100	0.073	Q5UIP0.pdb.gz	RIF1_HUMAN Telomere-associated protein RIF1 OS=Homo sapiens OX=9606 GN=RIF1 PE=1 SV=2
6	AFDB:F4IAT2	0.081	0.081	1.410E-6	1823	0.100	0.099	F4IAT2.pdb.gz	THOC2_ARATH THO complex subunit 2 OS=Arabidopsis thaliana OX=3702 GN=THO2 PE=1 SV=1
7	PDB:7wttK	0.158	0.230	2.902E-6	1022	0.092	0.162	7wttK.pdb.gz	The nucleoplasmic phase of pre-40S formation prior to nuclear export.
8	AFDB:Q498H0	0.092	0.106	3.917E-6	1448	0.112	0.140	Q498H0.pdb.gz	PD5BA_XENLA Sister chromatid cohesion protein PDS5 homolog B-A OS=Xenopus laevis OX=8355 GN=pds5b-a PE=1 SV=1
9	PDB:7unkA	0.107	0.156	6.762E-6	1047	0.077	0.134	7unkA.pdb.gz
10	AFDB:Q6TRW4	0.107	0.125	1.015E-5	1447	0.113	0.141	Q6TRW4.pdb.gz	PDS5B_RAT Sister chromatid cohesion protein PDS5 homolog B OS=Rattus norvegicus OX=10116 GN=Pds5b PE=1 SV=2
11	PDB:6vaeA	0.106	0.140	1.108E-5	1198	0.086	0.129	6vaeA.pdb.gz	DNA clamp function of the monoubiquitinated Fanconi anaemia ID complex.
12	PDB:6xu2A	0.110	0.157	1.189E-5	1091	0.076	0.126	6xu2A.pdb.gz	X-ray Structure of the Human Karyopherin RanBP5, an Essential Factor for Influenza Polymerase Nuclear Trafficking.
13	PDB:3w3uA	0.122	0.180	1.418E-5	1030	0.067	0.118	3w3uA.pdb.gz
14	PDB:6kwyc	0.107	0.107	1.691E-5	1811	0.077	0.077	6kwyc.pdb.gz	Cryo-EM structures of the human PA200 and PA200-20S complex reveal regulation of proteasome gate opening and two PA200 apertures.
15	AFDB:Q9VS24	0.116	0.183	2.364E-5	994	0.064	0.117	Q9VS24.pdb.gz	MELT_DROME Protein melted OS=Drosophila melanogaster OX=7227 GN=melt PE=1 SV=2
16	PDB:1qgkA	0.120	0.205	2.769E-5	876	0.065	0.134	1qgkA.pdb.gz
17	PDB:6gx9A	0.113	0.194	3.803E-5	912	0.079	0.158	6gx9A.pdb.gz	Differential role for phosphorylation in alternative polyadenylation function versus nuclear import of SR-like protein CPSF6.
18	PDB:6fvbA	0.135	0.201	3.940E-5	1001	0.078	0.142	6fvbA.pdb.gz
19	AFDB:A0A0G2JZW4	0.111	0.092	7.050E-5	2308	0.094	0.074	A0A0G2JZW4.pdb.gz	A0A0G2JZW4_RAT APC regulator of WNT signaling pathway 2 OS=Rattus norvegicus OX=10116 GN=Apc2 PE=3 SV=2
20	AFDB:F4I6B2	0.105	0.196	7.303E-5	811	0.060	0.134	F4I6B2.pdb.gz	F4I6B2_ARATH SIT4 phosphatase-associated family protein OS=Arabidopsis thaliana OX=3702 GN=At1g30470 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A2AIV2	0.0	3234	1811	0.957	0.957	VIR_MOUSE Protein virilizer homolog OS=Mus musculus OX=10090 GN=Virma PE=1 SV=1
2	Q69YN4	0.0	3725	1812	1.000	1.000	VIR_HUMAN Protein virilizer homolog OS=Homo sapiens OX=9606 GN=VIRMA PE=1 SV=2
3	Q9W1R5	3.66e-61	235	1854	0.146	0.142	VIR_DROME Protein virilizer OS=Drosophila melanogaster OX=7227 GN=vir PE=1 SV=1
4	F4J8G7	7.90e-05	50.4	2138	0.013	0.011	VIR_ARATH Protein virilizer homolog OS=Arabidopsis thaliana OX=3702 GN=VIR PE=1 SV=1
5	Q8IDY5	0.21	38.5	459	0.011	0.044	Q8IDY5_PLAF7 MSP7-like protein OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1334300 PE=4 SV=1
6	Q6FIU8	0.39	38.1	4880	0.018	0.007	Q6FIU8_CANGA Midasin OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0M11616g PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15912 VIR_N	4.1e-107	369.3	Virilizer, N-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000297591

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000282007	0.999	Zinc finger CCCH domain-containing protein 13
2	9606.ENSP00000298717	0.999	N6-adenosine-methyltransferase catalytic subunit
3	9606.ENSP00000351141	0.999	Pre-mRNA-splicing regulator WTAP
4	9606.ENSP00000373474	0.999	N6-adenosine-methyltransferase non-catalytic subunit
5	9606.ENSP00000401277	0.999	E3 ubiquitin-protein ligase Hakai
6	9606.ENSP00000358799	0.998	Putative RNA-binding protein 15
7	9606.ENSP00000454545	0.988	Putative RNA-binding protein 15B
8	9606.ENSP00000323348	0.879	E3 ubiquitin-protein ligase ZNF645
9	9606.ENSP00000317123	0.873	U5 small nuclear ribonucleoprotein 200 kDa helicase
10	9606.ENSP00000339245	0.866	YTH domain-containing protein 1
11	9606.ENSP00000382091	0.855	RNA demethylase ALKBH5
12	9606.ENSP00000359364	0.831	YTH domain-containing family protein 1
13	9606.ENSP00000478490	0.812	YTH domain-containing family protein 3
14	9606.ENSP00000161863	0.809	Probable ATP-dependent RNA helicase YTHDC2
15	9606.ENSP00000263092	0.800	U6 small nuclear RNA (adenine-(43)-N(6))-methyltransferase
16	9606.ENSP00000362918	0.789	YTH domain-containing family protein 2
17	9606.ENSP00000418823	0.783	Alpha-ketoglutarate-dependent dioxygenase FTO
18	9606.ENSP00000245838	0.775	THO complex subunit 2
19	9606.ENSP00000392094	0.765	116 kDa U5 small nuclear ribonucleoprotein component
20	9606.ENSP00000451291	0.745	Heterogeneous nuclear ribonucleoproteins C1/C2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding
GO:0003824	0.755	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.986	regulation of biological process
GO:0044237	0.986	cellular metabolic process
GO:0071704	0.982	organic substance metabolic process
GO:0050794	0.979	regulation of cellular process
GO:0016071	0.969	mRNA metabolic process
GO:0019222	0.965	regulation of metabolic process
GO:0060255	0.959	regulation of macromolecule metabolic process
GO:0080090	0.910	regulation of primary metabolic process
GO:0051171	0.909	regulation of nitrogen compound metabolic process
GO:0031323	0.902	regulation of cellular metabolic process
GO:0051252	0.876	regulation of RNA metabolic process
GO:0044260	0.875	cellular macromolecule metabolic process
GO:1903311	0.855	regulation of mRNA metabolic process
GO:0009451	0.760	RNA modification
GO:0043414	0.759	macromolecule methylation
GO:0001510	0.747	RNA methylation
GO:0016556	0.614	mRNA modification
GO:0050684	0.540	regulation of mRNA processing
GO:0010468	0.352	regulation of gene expression

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0036396	1.000	RNA N6-methyladenosine methyltransferase complex
GO:0005654	0.998	nucleoplasm
GO:0005829	0.992	cytosol
GO:0016604	0.931	nuclear body
GO:0016607	0.646	nuclear speck

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]