StarFunc result for job id Q69YQ0

User Input

>input (1117 residues)
MKKASRSVGSVPKVSAISKTQTAEKIKPENSSSASTGGKLVKPGTAASLSKTKSSDDLLA
GMAGGVTVTNGVKGKKSTCPSAAPSASAPAMTTVENKSKISTGTASSTKRSTSTGNKESS
STRERLRERTRLNQSKKLPSAGQGANDMALAKRSRSRTATECDVRMSKSKSDNQISDRAA
LEAKVKDLLTLAKTKDVEILHLRNELRDMRAQLGINEDHSEGDEKSEKETIMAHQPTDVE
STLLQLQEQNTAIREELNQLKNENRMLKDRLNALGFSLEQRLDNSEKLFGYQSLSPEITP
DNQSDGGGTLTSSVEGSAPGSVEDLLSQDENTLMDHQHSNSMDNLDSECSEVYQPLTSSD
DALDAPSSSESEGIPSIERSRKGSSGNASEVSVACLTERIHQMEENQHSTSEELQATLQE
LADLQQITQELNSENERLGEEKVILMESLCQQSDKLEHFSRQIEYFRSLLDEHHISYVID
EDVKSGRYMELEQRYMDLAENARFEREQLLGVQQHLSNTLKMAEQDNKEAQEMIGALKER
SHHMERIIESEQKGKAALAATLEEYKATVASDQIEMNRLKAQLENEKQKVAELYSIHNSG
DKSDIQDLLESVRLDKEKAETLASSLQEDLAHTRNDANRLQDAIAKVEDEYRAFQEEAKK
QIEDLNMTLEKLRSDLDEKETERSDMKETIFELEDEVEQHRAVKLHDNLIISDLENTVKK
LQDQKHDMEREIKTLHRRLREESAEWRQFQADLQTAVVIANDIKSEAQEEIGDLKRRLHE
AQEKNEKLTKELEEIKSRKQEEERGRVYNYMNAVERDLAALRQGMGLSRRSSTSSEPTPT
VKTLIKSFDSASQVPNPAAAAIPRTPLSPSPMKTPPAAAVSPMQRHSISGPISTSKPLTA
LSDKRPNYGEIPVQEHLLRTSSASRPASLPRVPAMESAKTLSVSRRSSEEVKRDISAQEG
ASPASLMAMGTTSPQLSLSSSPTASVTPTTRSRIREERKDPLSALAREYGGSKRNALLKW
CQKKTEGYQNIDITNFSSSWNDGLAFCALLHTYLPAHIPYQELNSQDKRRNFMLAFQAAE
SVGIKSTLDINEMVRTERPDWQNVMLYVTAIYKYFET

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A494C1J1	0.433	0.427	0.000	1136	0.975	0.959	A0A494C1J1.pdb.gz	A0A494C1J1_HUMAN Cytospin-A OS=Homo sapiens OX=9606 GN=SPECC1L PE=1 SV=1
2	AFDB:Q2KN98	0.505	0.505	0.000	1118	0.951	0.950	Q2KN98.pdb.gz	CYTSA_MOUSE Cytospin-A OS=Mus musculus OX=10090 GN=Specc1l PE=1 SV=1
3	AFDB:Q2KN93	0.506	0.500	2.047E-90	1132	0.699	0.690	Q2KN93.pdb.gz	CYTSA_DANRE Cytospin-A OS=Danio rerio OX=7955 GN=specc1la PE=2 SV=2
4	AFDB:E7FG55	0.321	0.321	1.626E-85	1121	0.654	0.651	E7FG55.pdb.gz	E7FG55_DANRE Cytospin-A OS=Danio rerio OX=7955 GN=specc1lb PE=3 SV=1
5	AFDB:A0A2R8RYD3	0.350	0.405	2.237E-74	948	0.594	0.699	A0A2R8RYD3.pdb.gz
6	AFDB:A0A024QYY9	0.234	0.242	2.262E-49	1068	0.386	0.404	A0A024QYY9.pdb.gz
7	AFDB:Q5SXY1	0.279	0.289	4.046E-49	1067	0.371	0.388	Q5SXY1.pdb.gz	CYTSB_MOUSE Cytospin-B OS=Mus musculus OX=10090 GN=Specc1 PE=1 SV=2
8	AFDB:E7F789	0.193	0.209	1.102E-45	1011	0.377	0.416	E7F789.pdb.gz
9	AFDB:A2ASQ4	0.138	0.146	3.697E-43	1035	0.365	0.394	A2ASQ4.pdb.gz
10	AFDB:Q0KHX7	0.196	0.200	3.160E-30	1094	0.269	0.275	Q0KHX7.pdb.gz	Q0KHX7_DROME FI18193p1 OS=Drosophila melanogaster OX=7227 GN=spdi PE=1 SV=1
11	PDB:4d1eA	0.094	0.120	7.111E-7	859	0.040	0.052	4d1eA.pdb.gz
12	PDB:1sjjA	0.080	0.103	3.585E-4	863	0.033	0.043	1sjjA.pdb.gz
13	PDB:2jj7B	0.046	0.162	6.497E-1	183	0.016	0.098	2jj7B.pdb.gz
14	PDB:4iubL	0.037	0.058	1.648	602	0.007	0.013	4iubL.pdb.gz	Reversible [4Fe-3S] cluster morphing in an O2-tolerant [NiFe] hydrogenase.
15	PDB:7pubFh	0.036	0.109	1.851	274	0.013	0.055	7pubFh.pdb.gz	Mitoribosomal small subunit maturation involves formation of initiation-like complexes.
16	PDB:3hmxB	0.035	0.134	2.336	176	0.017	0.108	3hmxB.pdb.gz
17	PDB:4a0oA	0.032	0.071	2.624	339	0.012	0.038	4a0oA.pdb.gz
18	PDB:4dl8A	0.038	0.100	2.781	224	0.015	0.076	4dl8A.pdb.gz	On the catalytic mechanism of dimeric dUTPases.
19	PDB:6awlA	0.048	0.164	2.781	217	0.021	0.111	6awlA.pdb.gz
20	PDB:7kpvB	0.045	0.127	2.781	290	0.012	0.045	7kpvB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A494C1J1	0.0	2196	1136	0.975	0.959	A0A494C1J1_HUMAN Cytospin-A OS=Homo sapiens OX=9606 GN=SPECC1L PE=1 SV=1
2	E7FG55	0.0	1305	1121	0.645	0.642	E7FG55_DANRE Cytospin-A OS=Danio rerio OX=7955 GN=specc1lb PE=3 SV=1
3	Q2KN93	0.0	1429	1132	0.694	0.685	CYTSA_DANRE Cytospin-A OS=Danio rerio OX=7955 GN=specc1la PE=2 SV=2
4	Q2KN98	0.0	2110	1118	0.952	0.951	CYTSA_MOUSE Cytospin-A OS=Mus musculus OX=10090 GN=Specc1l PE=1 SV=1
5	Q5M775	0.0	671	1068	0.408	0.427	CYTSB_HUMAN Cytospin-B OS=Homo sapiens OX=9606 GN=SPECC1 PE=1 SV=1
6	Q5SXY1	0.0	657	1067	0.397	0.415	CYTSB_MOUSE Cytospin-B OS=Mus musculus OX=10090 GN=Specc1 PE=1 SV=2
7	Q69YQ0	0.0	2286	1117	0.999	0.999	CYTSA_HUMAN Cytospin-A OS=Homo sapiens OX=9606 GN=SPECC1L PE=1 SV=3
8	J3KRB9	1.24e-141	440	574	0.225	0.437	J3KRB9_HUMAN Sperm antigen with calponin homology and coiled-coil domains 1 OS=Homo sapiens OX=9606 GN=SPECC1 PE=1 SV=2
9	J3QS22	4.18e-119	388	783	0.259	0.369	J3QS22_HUMAN Sperm antigen with calponin homology and coiled-coil domains 1 (Fragment) OS=Homo sapiens OX=9606 GN=SPECC1 PE=1 SV=9
10	X2JHS3	6.57e-109	365	949	0.243	0.286	X2JHS3_DROME Uncharacterized protein, isoform D OS=Drosophila melanogaster OX=7227 GN=spdi PE=4 SV=1
11	Q9W5E8	9.88e-109	364	950	0.243	0.285	Q9W5E8_DROME Uncharacterized protein, isoform A OS=Drosophila melanogaster OX=7227 GN=spdi PE=4 SV=2
12	Q9U4H0	6.07e-106	357	949	0.241	0.283	Q9U4H0_DROME EG:118B3.2 OS=Drosophila melanogaster OX=7227 GN=spdi PE=2 SV=1
13	X2J9Z8	2.21e-90	313	942	0.225	0.266	X2J9Z8_DROME Uncharacterized protein, isoform G OS=Drosophila melanogaster OX=7227 GN=spdi PE=4 SV=1
14	O77431	8.23e-90	314	1082	0.225	0.232	O77431_DROME EG:118B3.2 protein OS=Drosophila melanogaster OX=7227 GN=spdi PE=4 SV=1
15	Q0KHX7	2.37e-56	215	1094	0.089	0.090	Q0KHX7_DROME FI18193p1 OS=Drosophila melanogaster OX=7227 GN=spdi PE=1 SV=1
16	G5ECY7	6.24e-29	117	222	0.043	0.216	G5ECY7_CAEEL Calponin-homology (CH) domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=CELE_T15B12.1 PE=1 SV=1
17	Q9I8J4	8.51e-28	120	443	0.042	0.106	Q9I8J4_CHICK Smoothelin-C OS=Gallus gallus OX=9031 GN=Smtn PE=2 SV=1
18	G4SJU0	1.11e-27	119	432	0.043	0.111	G4SJU0_CAEEL Calponin-homology (CH) domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=CELE_T15B12.1 PE=1 SV=1
19	A8MU46	4.62e-25	112	494	0.040	0.091	SMTL1_HUMAN Smoothelin-like protein 1 OS=Homo sapiens OX=9606 GN=SMTNL1 PE=1 SV=2
20	Q99LM3	1.99e-24	110	459	0.039	0.096	SMTL1_MOUSE Smoothelin-like protein 1 OS=Mus musculus OX=10090 GN=Smtnl1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04108 ATG17_like	0.069	24.2	Autophagy protein ATG17-like domain
2	PF11971 CAMSAP_CH	0.15	23.2	CAMSAP CH domain
3	PF00307 CH	9.3e-18	75.8	Calponin homology (CH) domain
4	PF00042 Globin	1.3e+02	14.5	Globin
5	PF01920 Prefoldin_2	12	17.3	Prefoldin subunit
6	PF12329 TMF_DNA_bd	73	14.8	TATA element modulatory factor 1 DNA binding

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000325785

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000292385	0.729	Drebrin
2	9606.ENSP00000312671	0.716	EH domain-binding protein 1-like protein 1
3	9606.ENSP00000263991	0.715	EH domain-binding protein 1
4	9606.ENSP00000314992	0.701	Visual pigment-like receptor peropsin
5	9606.ENSP00000348099	0.691	PDZ and LIM domain protein 7
6	9606.ENSP00000333938	0.677	Nexilin
7	9606.ENSP00000299290	0.620	Protein TBATA
8	9606.ENSP00000253754	0.608	PDZ and LIM domain protein 4
9	9606.ENSP00000284770	0.608	PDZ and LIM domain protein 3
10	9606.ENSP00000312634	0.608	PDZ and LIM domain protein 2
11	9606.ENSP00000360305	0.608	PDZ and LIM domain protein 1
12	9606.ENSP00000401437	0.608	LIM domain-binding protein 3
13	9606.ENSP00000480359	0.608	PDZ and LIM domain protein 5
14	9606.ENSP00000484398	0.600	Smoothelin
15	9606.ENSP00000367059	0.587	Espin
16	9606.ENSP00000401010	0.586	F-actin-capping protein subunit beta
17	9606.ENSP00000397459	0.582	Dual specificity protein phosphatase 22
18	9606.ENSP00000261503	0.581	Cytospin-B
19	9606.ENSP00000265944	0.572	Myosin-IIIa
20	9606.ENSP00000352834	0.571	Unconventional myosin-Ic

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008013	0.913	beta-catenin binding
GO:0008092	0.636	cytoskeletal protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.987	cellular process
GO:0007155	0.813	cell adhesion
GO:0032501	0.523	multicellular organismal process
GO:0032502	0.522	developmental process
GO:0065007	0.483	biological regulation
GO:0048856	0.483	anatomical structure development
GO:0050789	0.457	regulation of biological process
GO:0050794	0.450	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0015629	0.999	actin cytoskeleton
GO:0005829	0.919	cytosol
GO:0043231	0.780	intracellular membrane-bounded organelle
GO:0032991	0.494	protein-containing complex
GO:0016020	0.370	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]