StarFunc result for job id Q6A162

User Input

>input (431 residues)
MTSDCSSTHCSPESCGTASGCAPASSCSVETACLPGTCATSRCQTPSFLSRSRGLTGCLL
PCYFTGSCNSPCLVGNCAWCEDGVFTSNEKETMQFLNDRLASYLEKVRSLEETNAELESR
IQEQCEQDIPMVCPDYQRYFNTIEDLQQKILCTKAENSRLAVQLDNCKLATDDFKSKYES
ELSLRQLLEADISSLHGILEELTLCKSDLEAHVESLKEDLLCLKKNHEEEVNLLREQLGD
RLSVELDTAPTLDLNRVLDEMRCQCETVLANNRREAEEWLAVQTEELNQQQLSSAEQLQG
CQMEILELKRTASALEIELQAQQSLTESLECTVAETEAQYSSQLAQIQCLIDNLENQLAE
IRCDLERQNQEYQVLLDVKARLEGEINTYWGLLDSEDSRLSCSPCSTTCTSSNTCEPCSA
YVICTVENCCL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6A162	1.000	1.000	2.178E-61	431	1.000	1.000	Q6A162.pdb.gz	K1C40_HUMAN Keratin, type I cytoskeletal 40 OS=Homo sapiens OX=9606 GN=KRT40 PE=1 SV=2
2	AFDB:O76013	0.511	0.477	4.516E-34	467	0.606	0.559	O76013.pdb.gz	KRT36_HUMAN Keratin, type I cuticular Ha6 OS=Homo sapiens OX=9606 GN=KRT36 PE=1 SV=1
3	AFDB:Q92764	0.514	0.491	6.142E-34	455	0.596	0.565	Q92764.pdb.gz	KRT35_HUMAN Keratin, type I cuticular Ha5 OS=Homo sapiens OX=9606 GN=KRT35 PE=1 SV=5
4	AFDB:B1AQ75	0.518	0.481	2.871E-32	473	0.587	0.535	B1AQ75.pdb.gz	KRT36_MOUSE Keratin, type I cuticular Ha6 OS=Mus musculus OX=10090 GN=Krt36 PE=1 SV=1
5	AFDB:Q14532	0.535	0.518	1.146E-31	448	0.578	0.556	Q14532.pdb.gz	K1H2_HUMAN Keratin, type I cuticular Ha2 OS=Homo sapiens OX=9606 GN=KRT32 PE=1 SV=3
6	AFDB:O76011	0.636	0.630	3.921E-31	436	0.601	0.594	O76011.pdb.gz	KRT34_HUMAN Keratin, type I cuticular Ha4 OS=Homo sapiens OX=9606 GN=KRT34 PE=1 SV=3
7	AFDB:Q15323	0.550	0.567	7.901E-29	416	0.573	0.594	Q15323.pdb.gz	K1H1_HUMAN Keratin, type I cuticular Ha1 OS=Homo sapiens OX=9606 GN=KRT31 PE=1 SV=3
8	AFDB:Q6IFW3	0.509	0.462	1.170E-26	481	0.520	0.466	Q6IFW3.pdb.gz	K1C39_RAT Keratin, type I cytoskeletal 39 OS=Rattus norvegicus OX=10116 GN=Krt39 PE=3 SV=1
9	AFDB:Q6A163	0.437	0.394	6.861E-26	491	0.517	0.454	Q6A163.pdb.gz	K1C39_HUMAN Keratin, type I cytoskeletal 39 OS=Homo sapiens OX=9606 GN=KRT39 PE=1 SV=2
10	AFDB:O76015	0.565	0.538	5.908E-25	456	0.517	0.489	O76015.pdb.gz	KRT38_HUMAN Keratin, type I cuticular Ha8 OS=Homo sapiens OX=9606 GN=KRT38 PE=1 SV=3
11	PDB:6qlfQ	0.133	0.260	1.367	204	0.079	0.167	6qlfQ.pdb.gz
12	PDB:6tdaL	0.120	0.093	5.894	596	0.056	0.040	6tdaL.pdb.gz	Structure of SWI/SNF chromatin remodeller RSC bound to a nucleosome.
13	PDB:7qooU	0.151	0.295	5.894	186	0.102	0.237	7qooU.pdb.gz	Structure of the human inner kinetochore CCAN complex and its significance for human centromere organization.
14	PDB:7c4jB	0.150	0.162	6.874	395	0.051	0.056	7c4jB.pdb.gz
15	PDB:6wucH	0.106	0.197	7.423	179	0.070	0.168	6wucH.pdb.gz
16	PDB:7mq9SI	0.103	0.065	8.016	844	0.032	0.017	7mq9SI.pdb.gz	Nucleolar maturation of the human small subunit processome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6A162	0.0	860	431	1.000	1.000	K1C40_HUMAN Keratin, type I cytoskeletal 40 OS=Homo sapiens OX=9606 GN=KRT40 PE=1 SV=2
2	O76013	3.26e-174	497	467	0.587	0.542	KRT36_HUMAN Keratin, type I cuticular Ha6 OS=Homo sapiens OX=9606 GN=KRT36 PE=1 SV=1
3	O76011	6.20e-169	483	436	0.596	0.589	KRT34_HUMAN Keratin, type I cuticular Ha4 OS=Homo sapiens OX=9606 GN=KRT34 PE=1 SV=3
4	B1AQ75	8.31e-169	484	473	0.587	0.535	KRT36_MOUSE Keratin, type I cuticular Ha6 OS=Mus musculus OX=10090 GN=Krt36 PE=1 SV=1
5	Q92764	2.35e-168	482	455	0.601	0.569	KRT35_HUMAN Keratin, type I cuticular Ha5 OS=Homo sapiens OX=9606 GN=KRT35 PE=1 SV=5
6	Q15323	1.14e-162	466	416	0.575	0.596	K1H1_HUMAN Keratin, type I cuticular Ha1 OS=Homo sapiens OX=9606 GN=KRT31 PE=1 SV=3
7	O76009	1.74e-162	465	404	0.568	0.606	KT33A_HUMAN Keratin, type I cuticular Ha3-I OS=Homo sapiens OX=9606 GN=KRT33A PE=2 SV=2
8	Q14532	6.25e-162	465	448	0.582	0.560	K1H2_HUMAN Keratin, type I cuticular Ha2 OS=Homo sapiens OX=9606 GN=KRT32 PE=1 SV=3
9	Q14525	3.78e-158	454	404	0.566	0.604	KT33B_HUMAN Keratin, type I cuticular Ha3-II OS=Homo sapiens OX=9606 GN=KRT33B PE=1 SV=3
10	Q6A163	3.82e-137	404	491	0.510	0.448	K1C39_HUMAN Keratin, type I cytoskeletal 39 OS=Homo sapiens OX=9606 GN=KRT39 PE=1 SV=2
11	Q6IFW3	5.50e-135	398	481	0.503	0.451	K1C39_RAT Keratin, type I cytoskeletal 39 OS=Rattus norvegicus OX=10116 GN=Krt39 PE=3 SV=1
12	O76015	1.18e-133	394	456	0.508	0.480	KRT38_HUMAN Keratin, type I cuticular Ha8 OS=Homo sapiens OX=9606 GN=KRT38 PE=1 SV=3
13	O76014	2.80e-133	392	449	0.515	0.494	KRT37_HUMAN Keratin, type I cuticular Ha7 OS=Homo sapiens OX=9606 GN=KRT37 PE=1 SV=3
14	Q6PVZ1	6.59e-115	346	467	0.399	0.368	K1C14_CHICK Keratin, type I cytoskeletal 14 OS=Gallus gallus OX=9031 GN=KRT14 PE=2 SV=1
15	Q9QWL7	8.21e-114	342	433	0.432	0.430	K1C17_MOUSE Keratin, type I cytoskeletal 17 OS=Mus musculus OX=10090 GN=Krt17 PE=1 SV=3
16	Q6IFU8	1.02e-113	342	433	0.427	0.425	K1C17_RAT Keratin, type I cytoskeletal 17 OS=Rattus norvegicus OX=10116 GN=Krt17 PE=1 SV=1
17	P19001	2.91e-113	340	403	0.392	0.419	K1C19_MOUSE Keratin, type I cytoskeletal 19 OS=Mus musculus OX=10090 GN=Krt19 PE=1 SV=1
18	Q04695	4.65e-113	340	432	0.406	0.405	K1C17_HUMAN Keratin, type I cytoskeletal 17 OS=Homo sapiens OX=9606 GN=KRT17 PE=1 SV=2
19	P08727	2.97e-112	337	400	0.381	0.410	K1C19_HUMAN Keratin, type I cytoskeletal 19 OS=Homo sapiens OX=9606 GN=KRT19 PE=1 SV=4
20	P02533	2.06e-110	335	472	0.392	0.358	K1C14_HUMAN Keratin, type I cytoskeletal 14 OS=Homo sapiens OX=9606 GN=KRT14 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF20492 ERM_helical	1e+02	14.4	Ezrin/radixin/moesin, alpha-helical domain
2	PF00038 Filament	7.6e-91	316.6	Intermediate filament protein
3	PF17456 TcpS	1.7e+02	13.7	Toxin-coregulated pilus protein S

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000366984

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000334866	0.624	Keratin-associated protein 15-1
2	9606.ENSP00000375430	0.592	Keratin-associated protein 3-1
3	9606.ENSP00000209718	0.549	Keratin, type I cytoskeletal 23
4	9606.ENSP00000274496	0.543	Protein YIPF5
5	9606.ENSP00000305263	0.538	Keratin, type I cytoskeletal 28
6	9606.ENSP00000334798	0.536	Keratin, type I cytoskeletal 26
7	9606.ENSP00000310573	0.534	Keratin, type I cytoskeletal 25
8	9606.ENSP00000301656	0.533	Keratin, type I cytoskeletal 27
9	9606.ENSP00000251643	0.527	Keratin, type I cytoskeletal 12
10	9606.ENSP00000264651	0.525	Keratin, type I cytoskeletal 24
11	9606.ENSP00000167588	0.517	Keratin, type I cytoskeletal 20
12	9606.ENSP00000355124	0.515	Keratin, type I cytoskeletal 19
13	9606.ENSP00000269576	0.513	Keratin, type I cytoskeletal 10
14	9606.ENSP00000373487	0.513	Keratin, type I cytoskeletal 18
15	9606.ENSP00000301653	0.511	Keratin, type I cytoskeletal 16
16	9606.ENSP00000246662	0.510	Keratin, type I cytoskeletal 9
17	9606.ENSP00000308452	0.507	Keratin, type I cytoskeletal 17
18	9606.ENSP00000246635	0.506	Keratin, type I cytoskeletal 13
19	9606.ENSP00000254043	0.505	Keratin, type I cytoskeletal 15
20	9606.ENSP00000167586	0.504	Keratin, type I cytoskeletal 14

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005198	0.968	structural molecule activity
GO:0005200	0.473	structural constituent of cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032502	0.985	developmental process
GO:0048856	0.788	anatomical structure development
GO:0009987	0.722	cellular process
GO:0008544	0.454	epidermis development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.997	cytosol
GO:0005576	0.958	extracellular region
GO:0043226	0.953	organelle
GO:0005615	0.896	extracellular space
GO:0043227	0.712	membrane-bounded organelle
GO:0043229	0.628	intracellular organelle
GO:0031982	0.586	vesicle
GO:0070062	0.492	extracellular exosome
GO:0043232	0.448	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]