StarFunc result for job id Q6A163

User Input

>input (491 residues)
MDTKGCTTTNSPSTPCQNCSRITNVSTISSNNGCHPGGLTVNNCQPAGHVLRIPWDQGCQ
PTPRFCRKPIYLMNNFNARFSLDDCSWYGEGINSNEKETMQILNERLANYLQKVRMLERE
NAELESKIQEESNKELPVLCPDYLSYYTTIEELQQKILCTKAENSRLVSQIDNTKLTADD
LRAKYEAEVSLRQLVESDANGLKQILNVLTLGKADLEAQVQSLKEELLCLKNNHKEEINS
LQCQLGERLDIEVTAAPSADLNQVLQEMRCQYEPIMETNRKDVEQWFNTQIEELNQQVVT
SSQQQQCCQKEIIELRRSVNTLEVELQAQHRMRDSQECILTETEARYTALLTQIQSLIDN
LEAQLAEIRCALERQNQEYEILLDVKSRLECEITTYRSLLESSDGKRPCYPRATKCEPSP
WTSCKSGAIESTAPACTSSSPCSLKEHCSACGPLSRILVKICTITKEIKDGKVISSYEHV
QPCFIIRPAKV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6A163	1.000	1.000	5.548E-67	491	1.000	1.000	Q6A163.pdb.gz	K1C39_HUMAN Keratin, type I cytoskeletal 39 OS=Homo sapiens OX=9606 GN=KRT39 PE=1 SV=2
2	AFDB:Q6IFW3	0.391	0.398	6.099E-43	481	0.735	0.751	Q6IFW3.pdb.gz	K1C39_RAT Keratin, type I cytoskeletal 39 OS=Rattus norvegicus OX=10116 GN=Krt39 PE=3 SV=1
3	AFDB:B1AQ75	0.505	0.521	3.994E-30	473	0.540	0.560	B1AQ75.pdb.gz	KRT36_MOUSE Keratin, type I cuticular Ha6 OS=Mus musculus OX=10090 GN=Krt36 PE=1 SV=1
4	AFDB:O76013	0.367	0.384	5.021E-29	467	0.552	0.580	O76013.pdb.gz	KRT36_HUMAN Keratin, type I cuticular Ha6 OS=Homo sapiens OX=9606 GN=KRT36 PE=1 SV=1
5	AFDB:O76011	0.412	0.457	2.075E-25	436	0.464	0.523	O76011.pdb.gz	KRT34_HUMAN Keratin, type I cuticular Ha4 OS=Homo sapiens OX=9606 GN=KRT34 PE=1 SV=3
6	AFDB:Q92764	0.386	0.413	1.097E-24	455	0.507	0.547	Q92764.pdb.gz	KRT35_HUMAN Keratin, type I cuticular Ha5 OS=Homo sapiens OX=9606 GN=KRT35 PE=1 SV=5
7	AFDB:Q15323	0.397	0.461	2.284E-24	416	0.481	0.567	Q15323.pdb.gz	K1H1_HUMAN Keratin, type I cuticular Ha1 OS=Homo sapiens OX=9606 GN=KRT31 PE=1 SV=3
8	AFDB:Q14532	0.412	0.447	2.609E-24	448	0.513	0.562	Q14532.pdb.gz	K1H2_HUMAN Keratin, type I cuticular Ha2 OS=Homo sapiens OX=9606 GN=KRT32 PE=1 SV=3
9	AFDB:Q6A162	0.394	0.437	8.908E-23	431	0.454	0.517	Q6A162.pdb.gz	K1C40_HUMAN Keratin, type I cytoskeletal 40 OS=Homo sapiens OX=9606 GN=KRT40 PE=1 SV=2
10	AFDB:Q6IFU8	0.567	0.634	4.536E-21	433	0.401	0.455	Q6IFU8.pdb.gz	K1C17_RAT Keratin, type I cytoskeletal 17 OS=Rattus norvegicus OX=10116 GN=Krt17 PE=1 SV=1
11	PDB:3otcA	0.054	0.093	2.535	264	0.018	0.034	3otcA.pdb.gz
12	PDB:5jzwA	0.054	0.068	3.310	381	0.014	0.018	5jzwA.pdb.gz
13	PDB:5jzwH	0.030	0.035	3.538	401	0.006	0.007	5jzwH.pdb.gz
14	PDB:2ymwB	0.060	0.044	4.320	685	0.010	0.007	2ymwB.pdb.gz
15	PDB:6fhmA	0.046	0.097	4.320	193	0.012	0.031	6fhmA.pdb.gz
16	PDB:6sb3A	0.038	0.033	4.618	604	0.008	0.007	6sb3A.pdb.gz
17	PDB:5c58A	0.050	0.038	4.936	667	0.008	0.006	5c58A.pdb.gz	Binding of HasA by its transmembrane receptor HasR follows a conformational funnel mechanism.
18	PDB:6xywBi	0.050	0.192	4.936	101	0.006	0.030	6xywBi.pdb.gz	Cryo-EM structure of the RNA-rich plant mitochondrial ribosome.
19	PDB:7qooP	0.051	0.101	4.936	233	0.012	0.026	7qooP.pdb.gz	Structure of the human inner kinetochore CCAN complex and its significance for human centromere organization.
20	PDB:3j9zSJ	0.038	0.133	5.639	103	0.014	0.068	3j9zSJ.pdb.gz	Activation of GTP hydrolysis in mRNA-tRNA translocation by elongation factor G.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6A163	0.0	1003	491	1.000	1.000	K1C39_HUMAN Keratin, type I cytoskeletal 39 OS=Homo sapiens OX=9606 GN=KRT39 PE=1 SV=2
2	Q6IFW3	0.0	670	481	0.735	0.751	K1C39_RAT Keratin, type I cytoskeletal 39 OS=Rattus norvegicus OX=10116 GN=Krt39 PE=3 SV=1
3	B1AQ75	1.26e-169	488	473	0.540	0.560	KRT36_MOUSE Keratin, type I cuticular Ha6 OS=Mus musculus OX=10090 GN=Krt36 PE=1 SV=1
4	O76013	3.60e-169	487	467	0.548	0.576	KRT36_HUMAN Keratin, type I cuticular Ha6 OS=Homo sapiens OX=9606 GN=KRT36 PE=1 SV=1
5	Q14532	9.54e-160	462	448	0.513	0.562	K1H2_HUMAN Keratin, type I cuticular Ha2 OS=Homo sapiens OX=9606 GN=KRT32 PE=1 SV=3
6	Q15323	5.61e-155	449	416	0.473	0.558	K1H1_HUMAN Keratin, type I cuticular Ha1 OS=Homo sapiens OX=9606 GN=KRT31 PE=1 SV=3
7	O76009	6.33e-155	448	404	0.473	0.574	KT33A_HUMAN Keratin, type I cuticular Ha3-I OS=Homo sapiens OX=9606 GN=KRT33A PE=2 SV=2
8	Q92764	7.47e-155	450	455	0.475	0.512	KRT35_HUMAN Keratin, type I cuticular Ha5 OS=Homo sapiens OX=9606 GN=KRT35 PE=1 SV=5
9	O76011	1.93e-151	441	436	0.452	0.509	KRT34_HUMAN Keratin, type I cuticular Ha4 OS=Homo sapiens OX=9606 GN=KRT34 PE=1 SV=3
10	Q14525	7.25e-151	438	404	0.466	0.567	KT33B_HUMAN Keratin, type I cuticular Ha3-II OS=Homo sapiens OX=9606 GN=KRT33B PE=1 SV=3
11	Q6A162	1.05e-143	421	431	0.448	0.510	K1C40_HUMAN Keratin, type I cytoskeletal 40 OS=Homo sapiens OX=9606 GN=KRT40 PE=1 SV=2
12	O76015	1.89e-129	385	456	0.458	0.493	KRT38_HUMAN Keratin, type I cuticular Ha8 OS=Homo sapiens OX=9606 GN=KRT38 PE=1 SV=3
13	O76014	1.65e-127	380	449	0.426	0.465	KRT37_HUMAN Keratin, type I cuticular Ha7 OS=Homo sapiens OX=9606 GN=KRT37 PE=1 SV=3
14	Q6IFU8	1.89e-109	333	433	0.373	0.423	K1C17_RAT Keratin, type I cytoskeletal 17 OS=Rattus norvegicus OX=10116 GN=Krt17 PE=1 SV=1
15	Q9QWL7	2.06e-109	333	433	0.373	0.423	K1C17_MOUSE Keratin, type I cytoskeletal 17 OS=Mus musculus OX=10090 GN=Krt17 PE=1 SV=3
16	Q04695	6.62e-109	332	432	0.373	0.424	K1C17_HUMAN Keratin, type I cytoskeletal 17 OS=Homo sapiens OX=9606 GN=KRT17 PE=1 SV=2
17	P08727	8.82e-108	328	400	0.334	0.410	K1C19_HUMAN Keratin, type I cytoskeletal 19 OS=Homo sapiens OX=9606 GN=KRT19 PE=1 SV=4
18	Q6PVZ1	3.23e-107	328	467	0.373	0.392	K1C14_CHICK Keratin, type I cytoskeletal 14 OS=Gallus gallus OX=9031 GN=KRT14 PE=2 SV=1
19	P19001	2.21e-106	324	403	0.336	0.409	K1C19_MOUSE Keratin, type I cytoskeletal 19 OS=Mus musculus OX=10090 GN=Krt19 PE=1 SV=1
20	P02533	5.16e-106	326	472	0.338	0.352	K1C14_HUMAN Keratin, type I cytoskeletal 14 OS=Homo sapiens OX=9606 GN=KRT14 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00038 Filament	5.2e-89	310.5	Intermediate filament protein
2	PF09180 ProRS-C_1	70	15.1	Prolyl-tRNA synthetase, C-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000347823

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000334798	0.568	Keratin, type I cytoskeletal 26
2	9606.ENSP00000305263	0.543	Keratin, type I cytoskeletal 28
3	9606.ENSP00000301656	0.536	Keratin, type I cytoskeletal 27
4	9606.ENSP00000209718	0.533	Keratin, type I cytoskeletal 23
5	9606.ENSP00000310573	0.531	Keratin, type I cytoskeletal 25
6	9606.ENSP00000372286	0.523	Keratin-associated protein 27-1
7	9606.ENSP00000264651	0.520	Keratin, type I cytoskeletal 24
8	9606.ENSP00000251643	0.515	Keratin, type I cytoskeletal 12
9	9606.ENSP00000269576	0.515	Keratin, type I cytoskeletal 10
10	9606.ENSP00000448228	0.513	Spermatogenesis-associated serine-rich protein 2
11	9606.ENSP00000254043	0.510	Keratin, type I cytoskeletal 15
12	9606.ENSP00000301653	0.509	Keratin, type I cytoskeletal 16
13	9606.ENSP00000308452	0.509	Keratin, type I cytoskeletal 17
14	9606.ENSP00000353742	0.508	Keratin-associated protein 26-1
15	9606.ENSP00000373487	0.508	Keratin, type I cytoskeletal 18
16	9606.ENSP00000231512	0.506	Keratinocyte-associated transmembrane protein 2
17	9606.ENSP00000335565	0.506	Keratin-associated protein 10-8
18	9606.ENSP00000479656	0.503	Keratin-associated protein 7-1
19	9606.ENSP00000246662	0.502	Keratin, type I cytoskeletal 9
20	9606.ENSP00000167586	0.501	Keratin, type I cytoskeletal 14

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005198	0.895	structural molecule activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.980	cellular process
GO:0032502	0.875	developmental process
GO:0045103	0.768	intermediate filament-based process
GO:0048856	0.474	anatomical structure development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.996	cytosol
GO:0043226	0.991	organelle
GO:0043232	0.946	intracellular non-membrane-bounded organelle
GO:0005576	0.885	extracellular region
GO:0045111	0.844	intermediate filament cytoskeleton
GO:0099512	0.835	supramolecular fiber
GO:0005615	0.747	extracellular space
GO:0099513	0.721	polymeric cytoskeletal fiber
GO:0005882	0.714	intermediate filament
GO:0043227	0.701	membrane-bounded organelle
GO:0043230	0.667	extracellular organelle
GO:1903561	0.655	extracellular vesicle
GO:0070062	0.529	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]