StarFunc result for job id Q6AI08

User Input

>input (1181 residues)
MAAVQVVGSWPSVQPREAPREAIPERGNGFRLLSARLCALRPDDSSSARTEIHLLFDQLI
SENYSEGSGVAPEDVSALLVQACRLVPLNQNHLVSKVSQLIHHLLNRLQVIVDEQHLDFL
LAYTISAIHQCSSWTHREILQALAALVYCNGSKCQKYLPELLGNTGLLMKLSDLAQSDPE
VRRAAVHCMANLCLSVPGQPYLEEPYQNVCFQAFLTILQSPKSSDMDDITFCMLLQNALK
GIQSLLNGGRMKLTQTDELGALLAVLKKFMFHGLPGLNIEMPTVLYPTPLPQYDGRTPIK
PQQSESSASRPTLNKKKKSKVKPKKIQQGEEEEKESSGEIEAAPVTGTGRVNLHEGNTWC
PSSLGVQSLPLDGSGAAEKDGVSSSFSSSSWKRVSSSESDFSDAEGGMQSKMRSYQAKVR
QGALVCFLSTIKSIEKKVLYGYWSAFIPDTPELGSPQSVSLMTLTLKDPSPKTRACALQV
LSAILEGSKQFLSVAEDTSDHRRAFTPFSVMIACSIRELHRCLLLALVAESSSQTVTQII
KCLANLVSNAPYDRLKLSLLTKVWNQIKPYIRHKDVNVRVSSLTLLGAIVSTHAPLPEVQ
LLLQQPCSSGLGNSNSATPHLSPPDWWKKAPAGPSLEETSVSSPKGSSEPCWLIRLCISI
VVLPKEDSCSGSDAGSAAGSTYEPSPMRLEALQVLTLLARGYFSMTQAYLMELGEVICKC
MGEADPSIQLHGAKLLEELGTGLIQQYKPDSTAAPDQRAPVFLVVMFWTMMLNGPLPRAL
QNSEHPTLQASACDALSSILPEAFSNLPNDRQMLCITVLLGLNDSKNRLVKAATSRALGV
YVLFPCLRQDVIFVADAANAILMSLEDKSLNVRAKAAWSLGNLTDTLIVNMETPDPSFQE
EFSGLLLLKMLRSAIEASKDKDKVKSNAVRALGNLLHFLQPSHIEKPTFAEIIEESIQAL
ISTVLTEAAMKVRWNACYAMGNVFKNPALPLGTAPWTSQAYNALTSVVTSCKNFKVRIRS
AAALSVPGKREQYGSVDQYARIWNALVTALQKSEDTIDFLEFKYCVSLRTQICQALIHLL
SLASASDLPCMKETLELSGNMVQSYILQFLKSGAEGDDTGAPHSPQERDQMVRMALKHMG
SIQAPTGDTARRAIMGFLEEILAVCFDSSGSQGALPGLTNQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6AI08	1.000	1.000	0.000	1181	1.000	1.000	Q6AI08.pdb.gz	HEAT6_HUMAN HEAT repeat-containing protein 6 OS=Homo sapiens OX=9606 GN=HEATR6 PE=1 SV=1
2	PDB:6xu2A	0.294	0.311	1.588E-12	1091	0.120	0.130	6xu2A.pdb.gz	X-ray Structure of the Human Karyopherin RanBP5, an Essential Factor for Influenza Polymerase Nuclear Trafficking.
3	PDB:1qgkA	0.366	0.467	7.367E-11	876	0.114	0.154	1qgkA.pdb.gz
4	PDB:7unkA	0.324	0.360	7.642E-11	1047	0.126	0.142	7unkA.pdb.gz
5	PDB:4a0cA	0.288	0.292	1.062E-10	1155	0.130	0.133	4a0cA.pdb.gz	The Molecular Basis of Crl4(Ddb2/Csa) Ubiquitin Ligase Architecture, Targeting, and Activation
6	PDB:3w3uA	0.301	0.329	5.110E-10	1030	0.117	0.134	3w3uA.pdb.gz
7	PDB:3w3zA	0.260	0.291	5.914E-10	1013	0.119	0.139	3w3zA.pdb.gz	Structural basis for cell-cycle-dependent nuclear import mediated by the karyopherin Kap121p.
8	PDB:3nd2A	0.326	0.419	1.184E-9	861	0.122	0.167	3nd2A.pdb.gz
9	AFDB:F1QQZ1	0.208	0.194	1.517E-9	1315	0.101	0.090	F1QQZ1.pdb.gz	F1QQZ1_DANRE Splicing factor 3B subunit 1 isoform X1 OS=Danio rerio OX=7955 GN=sf3b1 PE=1 SV=2
10	PDB:6x9oA	0.223	0.136	3.176E-9	2425	0.128	0.062	6x9oA.pdb.gz
11	AFDB:Q386J2	0.195	0.158	3.268E-9	1650	0.125	0.090	Q386J2.pdb.gz	Q386J2_TRYB2 LisH domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.0690 PE=3 SV=1
12	PDB:4jlqA	0.425	0.554	3.676E-9	840	0.117	0.164	4jlqA.pdb.gz	Crystal structure of human Karyopherin beta 2 bound to the PY-NLS of Saccharomyces cerevisiae Nab2.
13	PDB:6tc0C	0.195	0.221	3.955E-9	994	0.113	0.135	6tc0C.pdb.gz
14	AFDB:E3W994	0.130	0.122	4.539E-8	1273	0.145	0.134	E3W994.pdb.gz	E3W994_HUMAN Cytoplasmic linker associated protein 2 OS=Homo sapiens OX=9606 GN=CLASP2 PE=1 SV=2
15	AFDB:B7Z637	0.317	0.548	7.299E-8	600	0.077	0.152	B7Z637.pdb.gz	B7Z637_HUMAN Armadillo repeat-containing protein 8 OS=Homo sapiens OX=9606 GN=ARMC8 PE=1 SV=1
16	AFDB:Q9SFB6	0.132	0.119	1.310E-7	1367	0.112	0.097	Q9SFB6.pdb.gz	M3KE2_ARATH MAP3K epsilon protein kinase 2 OS=Arabidopsis thaliana OX=3702 GN=MAP3KE2 PE=2 SV=1
17	AFDB:Q95YF0	0.139	0.125	5.860E-7	1378	0.123	0.105	Q95YF0.pdb.gz	CLAP1_CAEEL Protein CLASP-1 OS=Caenorhabditis elegans OX=6239 GN=cls-1 PE=3 SV=1
18	AFDB:Q388H0	0.249	0.256	1.051E-6	1133	0.128	0.133	Q388H0.pdb.gz	Q388H0_TRYB2 Armadillo/beta-catenin-like repeat OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.61.2450 PE=4 SV=1
19	AFDB:P11075	0.141	0.095	1.819E-6	2009	0.122	0.072	P11075.pdb.gz	SEC7_YEAST Protein transport protein SEC7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SEC7 PE=1 SV=2
20	AFDB:Q9M086	0.189	0.139	4.064E-6	1883	0.122	0.076	Q9M086.pdb.gz	DCAF1_ARATH DDB1- and CUL4-associated factor homolog 1 OS=Arabidopsis thaliana OX=3702 GN=DCAF1 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6AI08	0.0	2426	1181	1.000	1.000	HEAT6_HUMAN HEAT repeat-containing protein 6 OS=Homo sapiens OX=9606 GN=HEATR6 PE=1 SV=1
2	F4JSY2	1.03e-25	117	1165	0.074	0.075	F4JSY2_ARATH ARM repeat superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At4g38120 PE=1 SV=1
3	Q586Z9	0.54	35.8	213	0.019	0.108	Q586Z9_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.26G9.1000 PE=4 SV=1
4	Q38B74	1.5	34.7	261	0.017	0.077	Q38B74_TRYB2 HIRA-interacting protein 5, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.1780 PE=3 SV=1
5	Q9BIB8	1.7	35.4	896	0.013	0.017	Q9BIB8_CAEEL Importin N-terminal domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=imb-1 PE=1 SV=3
6	Q8BIV3	1.8	35.4	1105	0.020	0.022	RNBP6_MOUSE Ran-binding protein 6 OS=Mus musculus OX=10090 GN=Ranbp6 PE=1 SV=3
7	P9WQD1	6.3	33.5	651	0.019	0.034	ACSA_MYCTU Acetyl-coenzyme A synthetase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=acsA PE=1 SV=1
8	Q9C6S5	6.7	33.1	495	0.037	0.089	PHSB_ARATH Probable polyamine transporter At1g31830 OS=Arabidopsis thaliana OX=3702 GN=At1g31830 PE=2 SV=1
9	F4IYK3	8.0	33.1	871	0.012	0.016	F4IYK3_ARATH ARM repeat superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At3g08943 PE=1 SV=2
10	Q0WML1	9.4	32.7	657	0.012	0.021	Q0WML1_ARATH ARM repeat superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At3g08947 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01602 Adaptin_N	1.6	18.8	Adaptin N terminal region
2	PF00514 Arm	1.9	19.9	Armadillo/beta-catenin-like repeat
3	PF13251 DUF4042	6.4e-63	223.2	Domain of unknown function (DUF4042)
4	PF02985 HEAT	1.7e-11	54.3	HEAT repeat
5	PF13646 HEAT_2	2e-13	61.9	HEAT repeats
6	PF13513 HEAT_EZ	2.8e-08	45.4	HEAT-like repeat
7	PF03130 HEAT_PBS	21	17.1	PBS lyase HEAT-like repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000184956

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000361066	0.872	Nuclear receptor coactivator 3
2	9606.ENSP00000366557	0.811	Crooked neck-like protein 1
3	9606.ENSP00000434466	0.756	Integrator complex subunit 4
4	9606.ENSP00000424417	0.742	Pleiotropic regulator 1
5	9606.ENSP00000261531	0.739	SNW domain-containing protein 1
6	9606.ENSP00000227524	0.731	Pre-mRNA-processing factor 19
7	9606.ENSP00000261778	0.731	Transport and golgi organization 6 homolog
8	9606.ENSP00000216036	0.715	Radial spoke head 14 homolog
9	9606.ENSP00000387006	0.714	Pre-mRNA-splicing factor CWC22 homolog
10	9606.ENSP00000460348	0.714	Pre-mRNA-processing-splicing factor 8
11	9606.ENSP00000381198	0.711	LisH domain and HEAT repeat-containing protein KIAA1468
12	9606.ENSP00000386023	0.707	Protein BUD31 homolog
13	9606.ENSP00000267812	0.700	Microfibrillar-associated protein 1
14	9606.ENSP00000236273	0.694	Pre-mRNA-splicing factor SYF2
15	9606.ENSP00000295709	0.673	Serine/threonine-protein kinase 36
16	9606.ENSP00000305790	0.672	Splicing factor 3B subunit 3
17	9606.ENSP00000405330	0.670	Estrogen receptor
18	9606.ENSP00000334148	0.669	WD repeat-containing protein 25
19	9606.ENSP00000357928	0.669	Pre-mRNA-processing factor 17
20	9606.ENSP00000199814	0.668	Pre-mRNA-splicing factor RBM22

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003723	1.000	RNA binding
GO:0005515	0.901	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.964	biological regulation
GO:0009987	0.936	cellular process
GO:0050789	0.924	regulation of biological process
GO:0050794	0.909	regulation of cellular process
GO:0032502	0.844	developmental process
GO:0032501	0.844	multicellular organismal process
GO:0048856	0.684	anatomical structure development
GO:0007275	0.642	multicellular organism development
GO:0048731	0.500	system development
GO:0019222	0.469	regulation of metabolic process
GO:0008152	0.407	metabolic process
GO:0031323	0.380	regulation of cellular metabolic process
GO:0060255	0.375	regulation of macromolecule metabolic process
GO:0048518	0.363	positive regulation of biological process
GO:0051171	0.362	regulation of nitrogen compound metabolic process
GO:0071840	0.346	cellular component organization or biogenesis
GO:0048522	0.342	positive regulation of cellular process
GO:0044237	0.335	cellular metabolic process
GO:0050896	0.309	response to stimulus
GO:0080090	0.309	regulation of primary metabolic process
GO:0071704	0.305	organic substance metabolic process
GO:0016043	0.300	cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0005829	0.978	cytosol
GO:0005634	0.970	nucleus
GO:0070013	0.969	intracellular organelle lumen
GO:0005654	0.957	nucleoplasm
GO:0032991	0.913	protein-containing complex
GO:0016020	0.827	membrane
GO:0043232	0.433	intracellular non-membrane-bounded organelle
GO:0071944	0.351	cell periphery
GO:0005886	0.322	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]