StarFunc result for job id Q6AI39

User Input

>input (1079 residues)
MDDDDDSCLLDLIGDPQALNYFLHGPSNKSSNDDLTNAGYSAANSNSIFANSSNADPKSS
LKGVSNQLGEGPSDGLPLSSSLQFLEDELESSPLPDLTEDQPFDILQKSLQEANITEQTL
AEEAYLDASIGSSQQFAQAQLHPSSSASFTQASNVSNYSGQTLQPIGVTHVPVGASFASN
TVGVQHGFMQHVGISVPSQHLSNSSQISGSGQIQLIGSFGNHPSMMTINNLDGSQIILKG
SGQQAPSNVSGGLLVHRQTPNGNSLFGNSSSSPVAQPVTVPFNSTNFQTSLPVHNIIIQR
GLAPNSNKVPINIQPKPIQMGQQNTYNVNNLGIQQHHVQQGISFASASSPQGSVVGPHMS
VNIVNQQNTRKPVTSQAVSSTGGSIVIHSPMGQPHAPQSQFLIPTSLSVSSNSVHHVQTI
NGQLLQTQPSQLISGQVASEHVMLNRNSSNMLRTNQPYTGPMLNNQNTAVHLVSGQTFAA
SGSPVIANHASPQLVGGQMPLQQASPTVLHLSPGQSSVSQGRPGFATMPSVTSMSGPSRF
PAVSSASTAHPSLGSAVQSGSSGSNFTGDQLTQPNRTPVPVSVSHRLPVSSSKSTSTFSN
TPGTGTQQQFFCQAQKKCLNQTSPISAPKTTDGLRQAQIPGLLSTTLPGQDSGSKVISAS
LGTAQPQQEKVVGSSPGHPAVQVESHSGGQKRPAAKQLTKGAFILQQLQRDQAHTVTPDK
SHFRSLSDAVQRLLSYHVCQGSMPTEEDLRKVDNEFETVATQLLKRTQAMLNKYRCLLLE
DAMRINPSAEMVMIDRMFNQEERASLSRDKRLALVDPEGFQADFCCSFKLDKAAHETQFG
RSDQHGSKASSSLQPPAKAQGRDRAKTGVTEPMNHDQFHLVPNHIVVSAEGNISKKTECL
GRALKFDKVGLVQYQSTSEEKASRREPLKASQCSPGPEGHRKTSSRSDHGTESKLSSILA
DSHLEMTCNNSFQDKSLRNSPKNEVLHTDIMKGSGEPQPDLQLTKSLETTFKNILELKKA
GRQPQSDPTVSGSVELDFPNFSPMASQENCLEKFIPDHSEGVVETDSILEAAVNSILEC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6AI39	1.000	1.000	0.000	1079	1.000	1.000	Q6AI39.pdb.gz	BICRL_HUMAN BRD4-interacting chromatin-remodeling complex-associated protein-like OS=Homo sapiens OX=9606 GN=BICRAL PE=1 SV=2
2	AFDB:Q8CHH5	0.317	0.318	0.000	1074	0.873	0.877	Q8CHH5.pdb.gz	BICRL_MOUSE BRD4-interacting chromatin-remodeling complex-associated protein-like OS=Mus musculus OX=10090 GN=Bicral PE=1 SV=2
3	AFDB:Q9NZM4	0.121	0.090	1.898E-20	1560	0.311	0.215	Q9NZM4.pdb.gz	BICRA_HUMAN BRD4-interacting chromatin-remodeling complex-associated protein OS=Homo sapiens OX=9606 GN=BICRA PE=1 SV=2
4	AFDB:F8VPZ9	0.100	0.075	4.447E-18	1578	0.297	0.203	F8VPZ9.pdb.gz	BICRA_MOUSE BRD4-interacting chromatin-remodeling complex-associated protein OS=Mus musculus OX=10090 GN=Bicra PE=1 SV=1
5	AFDB:Q9VED3	0.053	0.048	5.433E-7	1186	0.123	0.112	Q9VED3.pdb.gz	Q9VED3_DROME Stripe, isoform A OS=Drosophila melanogaster OX=7227 GN=sr PE=4 SV=1
6	AFDB:Q9Y2W1	0.038	0.042	5.632E-6	955	0.120	0.135	Q9Y2W1.pdb.gz	TR150_HUMAN Thyroid hormone receptor-associated protein 3 OS=Homo sapiens OX=9606 GN=THRAP3 PE=1 SV=2
7	AFDB:E1JJ76	0.048	0.048	1.011E-5	1165	0.165	0.153	E1JJ76.pdb.gz	E1JJ76_DROME Alhambra, isoform H OS=Drosophila melanogaster OX=7227 GN=Alh PE=4 SV=1
8	AFDB:P51521	0.053	0.044	1.011E-5	1351	0.145	0.115	P51521.pdb.gz	OVO_DROME Transcriptional regulator ovo OS=Drosophila melanogaster OX=7227 GN=ovo PE=1 SV=2
9	AFDB:O64572	0.042	0.039	1.492E-5	1211	0.143	0.127	O64572.pdb.gz	O64572_ARATH Expressed protein OS=Arabidopsis thaliana OX=3702 GN=At2g19390 PE=1 SV=2
10	AFDB:Q05860	0.047	0.039	4.219E-5	1466	0.135	0.100	Q05860.pdb.gz	FMN1_MOUSE Formin-1 OS=Mus musculus OX=10090 GN=Fmn1 PE=1 SV=2
11	PDB:6yxxE8	0.038	0.200	2.615	154	0.019	0.136	6yxxE8.pdb.gz	Structural Insights into the Mechanism of Mitoribosomal Large Subunit Biogenesis.
12	PDB:7pmkY	0.033	0.173	3.391	98	0.019	0.204	7pmkY.pdb.gz	A conserved mechanism for regulating replisome disassembly in eukaryotes.
13	PDB:7l08AL	0.038	0.172	3.618	174	0.016	0.098	7l08AL.pdb.gz	Distinct mechanisms of the human mitoribosome recycling and antibiotic resistance.
14	PDB:5n9jB	0.045	0.222	4.120	133	0.015	0.120	5n9jB.pdb.gz
15	PDB:7ajtUO	0.036	0.063	4.397	493	0.019	0.043	7ajtUO.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
16	PDB:7mqaSS	0.041	0.107	5.007	350	0.027	0.083	7mqaSS.pdb.gz	Nucleolar maturation of the human small subunit processome.
17	PDB:1f5vA	0.029	0.105	5.343	240	0.007	0.033	1f5vA.pdb.gz	Structure and site-directed mutagenesis of a flavoprotein from Escherichia coli that reduces nitrocompounds: alteration of pyridine nucleotide binding by a single amino acid substitution.
18	PDB:6yxyBi	0.055	0.205	5.343	192	0.015	0.083	6yxyBi.pdb.gz	Structural Insights into the Mechanism of Mitoribosomal Large Subunit Biogenesis.
19	PDB:7apkE	0.049	0.087	5.343	523	0.020	0.042	7apkE.pdb.gz
20	PDB:7pubFh	0.038	0.110	5.343	274	0.022	0.088	7pubFh.pdb.gz	Mitoribosomal small subunit maturation involves formation of initiation-like complexes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6AI39	0.0	2185	1079	1.000	1.000	BICRL_HUMAN BRD4-interacting chromatin-remodeling complex-associated protein-like OS=Homo sapiens OX=9606 GN=BICRAL PE=1 SV=2
2	Q8CHH5	0.0	1863	1074	0.862	0.866	BICRL_MOUSE BRD4-interacting chromatin-remodeling complex-associated protein-like OS=Mus musculus OX=10090 GN=Bicral PE=1 SV=2
3	Q9NZM4	8.27e-41	166	1560	0.089	0.062	BICRA_HUMAN BRD4-interacting chromatin-remodeling complex-associated protein OS=Homo sapiens OX=9606 GN=BICRA PE=1 SV=2
4	F8VPZ9	1.84e-38	159	1578	0.075	0.051	BICRA_MOUSE BRD4-interacting chromatin-remodeling complex-associated protein OS=Mus musculus OX=10090 GN=Bicra PE=1 SV=1
5	Q9VAP9	8.35e-05	49.3	2976	0.031	0.011	Q9VAP9_DROME Uncharacterized protein, isoform A OS=Drosophila melanogaster OX=7227 GN=Bicra PE=4 SV=2
6	A0A0B4KI51	8.43e-05	49.3	3003	0.031	0.011	A0A0B4KI51_DROME Uncharacterized protein, isoform B OS=Drosophila melanogaster OX=7227 GN=Bicra PE=4 SV=1
7	A0A0B4KI07	9.41e-05	49.3	2684	0.031	0.012	A0A0B4KI07_DROME Uncharacterized protein, isoform C OS=Drosophila melanogaster OX=7227 GN=Bicra PE=4 SV=1
8	G3V9H6	2.9	34.3	799	0.019	0.026	G3V9H6_RAT PPFIA binding protein 2 OS=Rattus norvegicus OX=10116 GN=Ppfibp2 PE=1 SV=2
9	A0A8I5ZVX1	3.0	34.3	981	0.019	0.021	A0A8I5ZVX1_RAT PPFIA binding protein 2 OS=Rattus norvegicus OX=10116 GN=Ppfibp2 PE=1 SV=1
10	A0A0G2K383	3.1	34.3	970	0.019	0.022	A0A0G2K383_RAT PPFIA binding protein 2 OS=Rattus norvegicus OX=10116 GN=Ppfibp2 PE=1 SV=1
11	A0A8I6ALR5	3.2	34.3	909	0.019	0.023	A0A8I6ALR5_RAT PPFIA binding protein 2 OS=Rattus norvegicus OX=10116 GN=Ppfibp2 PE=1 SV=1
12	Q9LF51	4.1	33.5	369	0.032	0.095	Q9LF51_ARATH Glutamine-rich protein OS=Arabidopsis thaliana OX=3702 GN=At5g17510 PE=1 SV=1
13	Q9BP41	6.8	33.1	1241	0.028	0.024	Q9BP41_DROME RanBP21 OS=Drosophila melanogaster OX=7227 GN=Ranbp21 PE=1 SV=1
14	Q8S3C0	7.0	33.1	519	0.018	0.037	D4FAD_THRSP Acyl-lipid (7-3)-desaturase OS=Thraustochytrium sp. OX=145168 GN=Fad4 PE=1 SV=1
15	Q587H5	8.0	33.1	1501	0.022	0.016	Q587H5_TRYB2 Protein kinase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=10C8.160 PE=4 SV=1
16	Q99323	8.4	33.1	2057	0.066	0.035	MYSN_DROME Myosin heavy chain, non-muscle OS=Drosophila melanogaster OX=7227 GN=zip PE=1 SV=2
17	P53112	8.5	32.3	341	0.029	0.091	PEX14_YEAST Peroxisomal membrane protein PEX14 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PEX14 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15249 GLTSCR1	2.9e-27	106.5	Conserved region of unknown function on GLTSCR protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000313933

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000419765	0.992	Bromodomain-containing protein 9
2	9606.ENSP00000378414	0.988	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1
3	9606.ENSP00000414516	0.959	Protein SSXT
4	9606.ENSP00000397552	0.957	Actin-like protein 6A
5	9606.ENSP00000395654	0.953	Transcription activator BRG1
6	9606.ENSP00000320485	0.948	AT-rich interactive domain-containing protein 1A
7	9606.ENSP00000344546	0.945	AT-rich interactive domain-containing protein 1B
8	9606.ENSP00000323967	0.944	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1
9	9606.ENSP00000254480	0.943	SWI/SNF complex subunit SMARCC1
10	9606.ENSP00000392617	0.942	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 2
11	9606.ENSP00000262188	0.938	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 3
12	9606.ENSP00000263121	0.937	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1
13	9606.ENSP00000265773	0.936	Probable global transcription activator SNF2L2
14	9606.ENSP00000267064	0.936	SWI/SNF complex subunit SMARCC2
15	9606.ENSP00000379946	0.936	BRD4-interacting chromatin-remodeling complex-associated protein
16	9606.ENSP00000445868	0.843	B-cell CLL/lymphoma 7 protein family member A
17	9606.ENSP00000160382	0.821	Actin-like protein 6B
18	9606.ENSP00000369674	0.733	B-cell CLL/lymphoma 7 protein family member C
19	9606.ENSP00000267163	0.720	Retinoblastoma-associated protein
20	9606.ENSP00000291890	0.720	Natural cytotoxicity triggering receptor 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.995	regulation of biological process
GO:0080090	0.990	regulation of primary metabolic process
GO:0051171	0.990	regulation of nitrogen compound metabolic process
GO:0031323	0.989	regulation of cellular metabolic process
GO:0048518	0.988	positive regulation of biological process
GO:0010468	0.980	regulation of gene expression
GO:0051252	0.979	regulation of RNA metabolic process
GO:0009893	0.975	positive regulation of metabolic process
GO:0048522	0.963	positive regulation of cellular process
GO:0009889	0.956	regulation of biosynthetic process
GO:0051173	0.953	positive regulation of nitrogen compound metabolic process
GO:0010556	0.947	regulation of macromolecule biosynthetic process
GO:0045893	0.940	positive regulation of DNA-templated transcription
GO:0009987	0.914	cellular process
GO:0071840	0.760	cellular component organization or biogenesis
GO:0006357	0.741	regulation of transcription by RNA polymerase II
GO:0016043	0.700	cellular component organization
GO:0048519	0.301	negative regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016514	1.000	SWI/SNF complex
GO:0031981	0.825	nuclear lumen
GO:0005654	0.607	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]