StarFunc result for job id Q6AW86

User Input

>input (544 residues)
MTFEDVAVYFSQEEWGLLDTAQRALYRHVMLENFTLVTSLGLSTSRPRVVIQLERGEEPW
VPSGKDMTLARNTYGRLNSGSWSLTEDRDVSGEWPRAFPDTPPGMTTSVFPVADACHSVK
SLQRQPGASPSQERKPTGVSVIYWERLLLGSRSDQASISLRLTSPLRPPKSSRPREKTFT
EYRVPGRQPRTPERQKPCAQEVPGRAFGNASDLKAASGGRDRRMGAAWQEPHRLLGGQEP
STWDELGEALHAGEKSFECRACSKVFVKSSDLLKHLRTHTGERPYECTQCGKAFSQTSHL
TQHQRIHSGETPYACPVCGKAFRHSSSLVRHQRIHTAEKSFRCSECGKAFSHGSNLSQHR
KIHAGGRPYACAQCGRRFCRNSHLIQHERTHTGEKPFVCALCGAAFSQGSSLFLHQRVHT
GEKPFACAQCGRSFSRSSNLTQHQLLHTGERPFRCVDCGKGFAKGAVLLSHRRIHTGEKP
FVCTQCGRAFRERPALLHHQRIHTTEKTNAAAPDCTPGPGFLQGHHRKVRRGGKPSPVLK
PAKV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O75467	0.571	0.562	1.955E-75	553	0.866	0.852	O75467.pdb.gz	Z324A_HUMAN Zinc finger protein 324A OS=Homo sapiens OX=9606 GN=ZNF324 PE=2 SV=1
2	AFDB:Q3KQV3	0.416	0.361	1.952E-43	632	0.395	0.340	Q3KQV3.pdb.gz	ZN792_HUMAN Zinc finger protein 792 OS=Homo sapiens OX=9606 GN=ZNF792 PE=1 SV=2
3	AFDB:P21506	0.450	0.428	3.004E-42	573	0.338	0.321	P21506.pdb.gz	ZNF10_HUMAN Zinc finger protein 10 OS=Homo sapiens OX=9606 GN=ZNF10 PE=1 SV=3
4	AFDB:A0A024R4S7	0.398	0.282	2.691E-40	792	0.353	0.242	A0A024R4S7.pdb.gz
5	AFDB:A0A0A0MS50	0.420	0.382	2.410E-38	604	0.358	0.323	A0A0A0MS50.pdb.gz	A0A0A0MS50_HUMAN Zinc finger protein 300 OS=Homo sapiens OX=9606 GN=ZNF300 PE=1 SV=1
6	AFDB:Q80V81	0.352	0.319	4.995E-38	607	0.353	0.316	Q80V81.pdb.gz	Q80V81_MOUSE Zinc finger protein 819 OS=Mus musculus OX=10090 GN=Zfp819 PE=1 SV=1
7	AFDB:Q96MU6	0.329	0.256	8.630E-38	729	0.346	0.258	Q96MU6.pdb.gz	ZN778_HUMAN Zinc finger protein 778 OS=Homo sapiens OX=9606 GN=ZNF778 PE=1 SV=3
8	AFDB:E9PYI1	0.349	0.288	2.575E-37	671	0.342	0.277	E9PYI1.pdb.gz	ZN568_MOUSE Zinc finger protein 568 OS=Mus musculus OX=10090 GN=Znf568 PE=1 SV=1
9	AFDB:Q9HCZ1	0.397	0.327	4.449E-37	680	0.324	0.259	Q9HCZ1.pdb.gz	ZN334_HUMAN Zinc finger protein 334 OS=Homo sapiens OX=9606 GN=ZNF334 PE=1 SV=2
10	AFDB:Q3SY52	0.366	0.402	6.028E-37	487	0.344	0.384	Q3SY52.pdb.gz	ZIK1_HUMAN Zinc finger protein interacting with ribonucleoprotein K OS=Homo sapiens OX=9606 GN=ZIK1 PE=1 SV=1
11	PDB:3w5kB	0.092	0.272	3.525E-4	110	0.068	0.336	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:5c8dE	0.080	0.101	2.647E-1	280	0.048	0.093	5c8dE.pdb.gz	Structural basis for gene regulation by a B12-dependent photoreceptor.
13	PDB:5dkaA	0.056	0.220	6.582E-1	96	0.035	0.198	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
14	PDB:3javA	0.077	0.032	6.995E-1	2327	0.125	0.029	3javA.pdb.gz
15	PDB:6o9lQ	0.055	0.066	7.898E-1	430	0.086	0.109	6o9lQ.pdb.gz	Transcription preinitiation complex structure and dynamics provide insight into genetic diseases.
16	PDB:6ydhA	0.031	0.169	7.898E-1	62	0.026	0.226	6ydhA.pdb.gz
17	PDB:7vo0G	0.054	0.135	1.637	131	0.035	0.145	7vo0G.pdb.gz	Structural basis of Streptomyces transcription activation by zinc uptake regulator.
18	PDB:7ena4	0.076	0.084	2.218	457	0.057	0.068	7ena4.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
19	PDB:7fikP	0.066	0.063	2.828	593	0.039	0.035	7fikP.pdb.gz
20	PDB:7o4iW	0.048	0.074	2.828	312	0.064	0.112	7o4iW.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O75467	0.0	947	553	0.851	0.837	Z324A_HUMAN Zinc finger protein 324A OS=Homo sapiens OX=9606 GN=ZNF324 PE=2 SV=1
2	Q96HQ0	1.10e-128	387	510	0.386	0.412	ZN419_HUMAN Zinc finger protein 419 OS=Homo sapiens OX=9606 GN=ZNF419 PE=1 SV=2
3	A0A0C4DG42	1.22e-127	385	539	0.408	0.412	A0A0C4DG42_HUMAN Zinc finger protein 34 OS=Homo sapiens OX=9606 GN=ZNF34 PE=1 SV=1
4	Q8IZ26	1.95e-127	385	560	0.408	0.396	ZNF34_HUMAN Zinc finger protein 34 OS=Homo sapiens OX=9606 GN=ZNF34 PE=1 SV=3
5	P15622	1.58e-124	378	560	0.410	0.398	ZN250_HUMAN Zinc finger protein 250 OS=Homo sapiens OX=9606 GN=ZNF250 PE=1 SV=3
6	P52742	3.90e-122	375	658	0.421	0.348	ZN135_HUMAN Zinc finger protein 135 OS=Homo sapiens OX=9606 GN=ZNF135 PE=1 SV=3
7	A0A0A0MS50	6.34e-121	370	604	0.395	0.356	A0A0A0MS50_HUMAN Zinc finger protein 300 OS=Homo sapiens OX=9606 GN=ZNF300 PE=1 SV=1
8	Q3KQV3	6.45e-119	366	632	0.406	0.350	ZN792_HUMAN Zinc finger protein 792 OS=Homo sapiens OX=9606 GN=ZNF792 PE=1 SV=2
9	Q8NA42	7.11e-119	361	475	0.377	0.432	ZN383_HUMAN Zinc finger protein 383 OS=Homo sapiens OX=9606 GN=ZNF383 PE=1 SV=1
10	Q8TAQ5	2.78e-118	366	688	0.415	0.328	ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens OX=9606 GN=ZNF420 PE=1 SV=1
11	Q68DY9	2.97e-118	360	489	0.368	0.409	ZN772_HUMAN Zinc finger protein 772 OS=Homo sapiens OX=9606 GN=ZNF772 PE=1 SV=2
12	Q3V362	3.78e-118	363	622	0.384	0.336	Q3V362_MOUSE Zinc finger protein 251 (Fragment) OS=Mus musculus OX=10090 GN=Zfp251 PE=2 SV=1
13	Q3USU9	4.36e-118	364	632	0.384	0.331	Q3USU9_MOUSE Zinc finger protein 251 OS=Mus musculus OX=10090 GN=Zfp251 PE=2 SV=1
14	Q6PCX8	5.46e-118	363	632	0.384	0.331	Q6PCX8_MOUSE Zinc finger protein 251 OS=Mus musculus OX=10090 GN=Zfp251 PE=2 SV=1
15	Q03923	1.26e-116	359	595	0.364	0.333	ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens OX=9606 GN=ZNF85 PE=1 SV=3
16	Q96JC4	2.22e-116	356	524	0.351	0.365	ZN479_HUMAN Zinc finger protein 479 OS=Homo sapiens OX=9606 GN=ZNF479 PE=1 SV=1
17	Q86Y25	5.24e-116	356	554	0.375	0.368	Z354C_HUMAN Zinc finger protein 354C OS=Homo sapiens OX=9606 GN=ZNF354C PE=1 SV=1
18	Q6ECI4	2.54e-115	359	717	0.375	0.285	ZN470_HUMAN Zinc finger protein 470 OS=Homo sapiens OX=9606 GN=ZNF470 PE=2 SV=3
19	P35789	2.93e-115	356	620	0.349	0.306	ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens OX=9606 GN=ZNF93 PE=1 SV=4
20	Q8WV37	1.21e-114	352	535	0.373	0.379	ZN480_HUMAN Zinc finger protein 480 OS=Homo sapiens OX=9606 GN=ZNF480 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01722 BolA	3.3e+02	13.0	BolA-like protein
2	PF07975 C1_4	1e+02	14.6	TFIIH C1-like domain
3	PF09538 FYDLN_acid	1.9e+02	14.1	Protein of unknown function (FYDLN_acid)
4	PF19335 HMBD	2.8e+02	12.8	Heavy metal binding domain
5	PF01155 HypA	35	15.9	Hydrogenase/urease nickel incorporation, metallochaperone, hypA
6	PF01352 KRAB	1.4e-19	80.7	KRAB box
7	PF00412 LIM	9	17.9	LIM domain
8	PF01428 zf-AN1	4.6e+02	12.4	AN1-like Zinc finger
9	PF00096 zf-C2H2	7.6e-44	156.9	Zinc finger, C2H2 type
10	PF16622 zf-C2H2_11	36	15.5	zinc-finger C2H2-type
11	PF13894 zf-C2H2_4	2.1e-25	98.2	C2H2-type zinc finger
12	PF13912 zf-C2H2_6	7.1e-08	43.5	C2H2-type zinc finger
13	PF12171 zf-C2H2_jaz	6.9e-09	47.0	Zinc-finger double-stranded RNA-binding
14	PF13913 zf-C2HC_2	1.1e+02	14.1	zinc-finger of a C2HC-type
15	PF13465 zf-H2C2_2	5.4e-61	211.7	Zinc-finger double domain
16	PF08790 zf-LYAR	6.5e+02	11.6	LYAR-type C2HC zinc finger
17	PF12874 zf-met	6.5e+02	12.1	Zinc-finger of C2H2 type
18	PF18439 zf_UBZ	0.088	23.8	Ubiquitin-Binding Zinc Finger
19	PF17032 zinc_ribbon_15	1	21.5	zinc-ribbon family
20	PF09723 Zn-ribbon_8	5.8e-06	37.6	Zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000337473

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000375073	0.662	EP300-interacting inhibitor of differentiation 2
2	9606.ENSP00000350934	0.660	Rab GTPase-binding effector protein 2
3	9606.ENSP00000375844	0.545	Calpain-10
4	9606.ENSP00000419475	0.520	COMM domain-containing protein 2
5	9606.ENSP00000238831	0.516	Protein YIPF4
6	9606.ENSP00000403067	0.511	FERM domain-containing protein 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.966	regulation of cellular process
GO:0009987	0.949	cellular process
GO:0051171	0.767	regulation of nitrogen compound metabolic process
GO:0080090	0.759	regulation of primary metabolic process
GO:0031323	0.755	regulation of cellular metabolic process
GO:0060255	0.748	regulation of macromolecule metabolic process
GO:0010468	0.663	regulation of gene expression
GO:0010556	0.633	regulation of macromolecule biosynthetic process
GO:0031326	0.633	regulation of cellular biosynthetic process
GO:0044770	0.626	cell cycle phase transition
GO:0048523	0.609	negative regulation of cellular process
GO:0044843	0.487	cell cycle G1/S phase transition
GO:0051252	0.369	regulation of RNA metabolic process
GO:2001141	0.364	regulation of RNA biosynthetic process
GO:0010605	0.358	negative regulation of macromolecule metabolic process
GO:0006355	0.354	regulation of DNA-templated transcription
GO:0044772	0.305	mitotic cell cycle phase transition
GO:0000082	0.302	G1/S transition of mitotic cell cycle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.995	nucleoplasm
GO:0005737	0.731	cytoplasm
GO:0043232	0.307	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]