StarFunc result for job id Q6AWC2

User Input

>input (1192 residues)
MPRRAGSGQLPLPRGWEEARDYDGKVFYIDHNTRRTSWIDPRDRLTKPLSFADCVGDELP
WGWEAGFDPQIGVYYIDHINKTTQIEDPRKQWRGEQEKMLKDYLSVAQDALRTQKELYHV
KEQRLALALDEYVRLNDAYKEKSSSHTSLFSGSSSSTKYDPDILKAEISTTRLRVKKLKR
ELSQMKQELLYKEQGFETLQQIDKKMSGGQSGYELSEAKAILTELKSIRKAISSGEKEKQ
DLMQSLAKLQERFHLDQNIGRSEPDLRCSPVNSHLCLSRQTLDAGSQTSISGDIGVRSRS
NLAEKVRLSLQYEEAKRSMANLKIELSKLDSEAWPGALDIEKEKLMLINEKEELLKELQF
VTPQKRTQDELERLEAERQRLEEELLSVRGTPSRALAERLRLEERRKELLQKLEETTKLT
TYLHSQLKSLSASTLSMSSGSSLGSLASSRGSLNTSSRGSLNSLSSTELYYSSQSDQIDV
DYQYKLDFLLQEKSGYIPSGPITTIHENEVVKSPSQPGQSGLCGVAAAATGHTPPLAEAP
KSVASLSSRSSLSSLSPPGSPLVLEGTFPMSSSHDASLHQFTADFEDCELSSHFADISLI
ENQILLDSDSGGASQSLSEDKDLNECAREPLYEGTADVEKSLPKRRVIHLLGEKTTCVSA
AVSDESVAGDSGVYEAFVKQPSEMEDVTYSEEDVAIVETAQVQIGLRYNAKSSSFMVIIA
QLRNLHAFLIPHTSKVYFRVAVLPSSTDVSCLFRTKVHPPTESILFNDVFRVAISQTALQ
QKTLRVDLCSVSKHRREECLAGTQISLADLPFSSEVFTLWYNLLPSKQMPCKKNEENEDS
VFQPNQPLVDSIDLDAVSALLARTSAELLAVEQELAQEEEEESGQEEPRGPDGDWLTMLR
EASDEIVAEKEAEVKLPEDSSCTEDLSSCTSVPEMNEDGNRKESNCAKDLRSQPPTRIPT
LVDKETNTDEAANDNMAVRPKERSSLSSRQHPFVRSSVIVRSQTFSPGERNQYICRLNRS
DSDSSTLAKKSLFVRNSTERRSLRVKRTVCQSVLRRTTQECPVRTSLDLELDLQASLTRQ
SRLNDELQALRDLRQKLEELKAQGETDLPPGVLEDERFQRLLKQAEKQAEQSKEEQKQGL
NAEKLMRQVSKDVCRLREQSQKVPRQVQSFREKIAYFTRAKISIPSLPADDV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6AWC2	1.000	1.000	0.000	1192	1.000	1.000	Q6AWC2.pdb.gz	WWC2_HUMAN Protein WWC2 OS=Homo sapiens OX=9606 GN=WWC2 PE=1 SV=2
2	AFDB:Q8IX03	0.403	0.428	8.529E-84	1113	0.483	0.518	Q8IX03.pdb.gz	KIBRA_HUMAN Protein KIBRA OS=Homo sapiens OX=9606 GN=WWC1 PE=1 SV=1
3	AFDB:Q9ULE0	0.288	0.311	3.452E-61	1092	0.398	0.435	Q9ULE0.pdb.gz	WWC3_HUMAN Protein WWC3 OS=Homo sapiens OX=9606 GN=WWC3 PE=1 SV=3
4	AFDB:Q9VFG8	0.347	0.324	5.840E-54	1288	0.302	0.280	Q9VFG8.pdb.gz	KIBRA_DROME Protein kibra OS=Drosophila melanogaster OX=7227 GN=kibra PE=1 SV=2
5	AFDB:Q9JIS1	0.113	0.090	6.326E-10	1555	0.103	0.079	Q9JIS1.pdb.gz	RIMS2_RAT Regulating synaptic membrane exocytosis protein 2 OS=Rattus norvegicus OX=10116 GN=Rims2 PE=1 SV=1
6	AFDB:Q99NE5	0.096	0.078	1.617E-9	1463	0.104	0.085	Q99NE5.pdb.gz	RIMS1_MOUSE Regulating synaptic membrane exocytosis protein 1 OS=Mus musculus OX=10090 GN=Rims1 PE=1 SV=2
7	AFDB:Q9JIR4	0.097	0.075	1.287E-8	1615	0.092	0.068	Q9JIR4.pdb.gz	RIMS1_RAT Regulating synaptic membrane exocytosis protein 1 OS=Rattus norvegicus OX=10116 GN=Rims1 PE=1 SV=1
8	AFDB:A8JR10	0.098	0.162	2.045E-7	708	0.057	0.096	A8JR10.pdb.gz	A8JR10_DROME Bitesize, isoform E OS=Drosophila melanogaster OX=7227 GN=btsz PE=4 SV=1
9	PDB:3pfqA	0.096	0.211	2.298E-7	523	0.017	0.038	3pfqA.pdb.gz	Crystal Structure and Allosteric Activation of Protein Kinase C beta II
10	AFDB:P41885	0.098	0.106	1.361E-5	1106	0.058	0.062	P41885.pdb.gz	RBF1_CAEEL Rabphilin-1 OS=Caenorhabditis elegans OX=6239 GN=rbf-1 PE=2 SV=2
11	AFDB:P49796	0.101	0.100	3.151E-5	1198	0.070	0.069	P49796.pdb.gz	RGS3_HUMAN Regulator of G-protein signaling 3 OS=Homo sapiens OX=9606 GN=RGS3 PE=1 SV=2
12	PDB:5ixcA	0.069	0.117	1.303E-3	684	0.017	0.029	5ixcA.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
13	PDB:1cjyA	0.073	0.133	2.243E-3	633	0.012	0.022	1cjyA.pdb.gz	Crystal structure of human cytosolic phospholipase A2 reveals a novel topology and catalytic mechanism.
14	PDB:5izrC	0.068	0.117	4.705E-3	659	0.017	0.030	5izrC.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
15	PDB:5itdA	0.062	0.073	5.456E-3	995	0.020	0.024	5itdA.pdb.gz	Discovery and Pharmacological Characterization of Novel Quinazoline-Based PI3K Delta-Selective Inhibitors.
16	PDB:5iz5B	0.072	0.111	7.338E-3	746	0.016	0.025	5iz5B.pdb.gz
17	PDB:5a50A	0.066	0.419	1.089E-2	165	0.009	0.067	5a50A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
18	PDB:5a52A	0.055	0.378	1.202E-2	154	0.010	0.078	5a52A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
19	PDB:5iz5A	0.066	0.101	2.522E-2	757	0.014	0.022	5iz5A.pdb.gz
20	PDB:7mezA	0.060	0.071	2.650E-2	989	0.014	0.017	7mezA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9QGC4	0.0	700	1112	0.371	0.397	E9QGC4_DANRE Protein KIBRA OS=Danio rerio OX=7955 GN=wwc1 PE=4 SV=2
2	F1M6U0	0.0	874	1108	0.485	0.522	F1M6U0_RAT WW and C2 domain containing 1 OS=Rattus norvegicus OX=10116 GN=Wwc1 PE=1 SV=3
3	Q5SXA9	0.0	885	1104	0.488	0.527	KIBRA_MOUSE Protein KIBRA OS=Mus musculus OX=10090 GN=Wwc1 PE=1 SV=1
4	Q6AWC2	0.0	2429	1192	1.000	1.000	WWC2_HUMAN Protein WWC2 OS=Homo sapiens OX=9606 GN=WWC2 PE=1 SV=2
5	Q8IX03	0.0	904	1113	0.495	0.530	KIBRA_HUMAN Protein KIBRA OS=Homo sapiens OX=9606 GN=WWC1 PE=1 SV=1
6	Q9ULE0	8.00e-104	355	1092	0.169	0.184	WWC3_HUMAN Protein WWC3 OS=Homo sapiens OX=9606 GN=WWC3 PE=1 SV=3
7	Q9VFG8	5.73e-83	298	1288	0.139	0.129	KIBRA_DROME Protein kibra OS=Drosophila melanogaster OX=7227 GN=kibra PE=1 SV=2
8	Q9JK71	1.23e-18	94.7	1470	0.036	0.029	MAGI3_RAT Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 OS=Rattus norvegicus OX=10116 GN=Magi3 PE=1 SV=2
9	Q9EQJ9	1.42e-18	94.7	1476	0.036	0.029	MAGI3_MOUSE Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 OS=Mus musculus OX=10090 GN=Magi3 PE=1 SV=2
10	Q5TCQ9	1.69e-18	94.4	1481	0.033	0.026	MAGI3_HUMAN Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 OS=Homo sapiens OX=9606 GN=MAGI3 PE=1 SV=3
11	Q5F488	2.06e-18	94.0	1128	0.034	0.035	MAGI3_CHICK Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 OS=Gallus gallus OX=9031 GN=MAGI3 PE=2 SV=1
12	F1Q897	1.28e-17	91.7	1503	0.034	0.027	F1Q897_DANRE Membrane-associated guanylate kinase, WW and PDZ domain-containing 2a OS=Danio rerio OX=7955 GN=fb82g11 PE=4 SV=3
13	O88382	1.50e-17	91.3	1277	0.034	0.032	MAGI2_RAT Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2 OS=Rattus norvegicus OX=10116 GN=Magi2 PE=1 SV=1
14	Q9WVQ1	1.99e-17	90.9	1275	0.034	0.032	MAGI2_MOUSE Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2 OS=Mus musculus OX=10090 GN=Magi2 PE=1 SV=2
15	Q86UL8	2.04e-17	90.9	1455	0.034	0.028	MAGI2_HUMAN Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2 OS=Homo sapiens OX=9606 GN=MAGI2 PE=1 SV=3
16	Q9W2L2	2.16e-17	90.5	1202	0.033	0.032	Q9W2L2_DROME LD27118p OS=Drosophila melanogaster OX=7227 GN=Magi PE=1 SV=2
17	H7C5T8	6.06e-17	89.0	1014	0.036	0.042	H7C5T8_HUMAN Membrane associated guanylate kinase, WW and PDZ domain containing 1 (Fragment) OS=Homo sapiens OX=9606 GN=MAGI1 PE=1 SV=1
18	H7C4U7	6.12e-17	89.0	1131	0.036	0.038	H7C4U7_HUMAN Membrane associated guanylate kinase, WW and PDZ domain containing 1 (Fragment) OS=Homo sapiens OX=9606 GN=MAGI1 PE=1 SV=1
19	Q6RHR9	7.01e-17	89.0	1471	0.037	0.030	MAGI1_MOUSE Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 OS=Mus musculus OX=10090 GN=Magi1 PE=1 SV=1
20	A0A8I3NPD4	7.55e-17	89.0	1398	0.036	0.031	A0A8I3NPD4_CANLF Membrane associated guanylate kinase, WW and PDZ domain containing 1 OS=Canis lupus familiaris OX=9615 GN=MAGI1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07471 Phage_Nu1	1.4	20.1	Phage DNA packaging protein Nu1
2	PF00397 WW	6.2e-16	69.5	WW domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000384222

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000343899	0.832	FERM domain containing 6
2	9606.ENSP00000283309	0.808	FERM domain containing 1
3	9606.ENSP00000437550	0.757	Serine/threonine-protein kinase LATS1
4	9606.ENSP00000372035	0.742	Serine/threonine-protein kinase LATS2
5	9606.ENSP00000344666	0.659	Merlin
6	9606.ENSP00000355923	0.655	Tyrosine-protein phosphatase non-receptor type 14
7	9606.ENSP00000390590	0.642	Dendrin
8	9606.ENSP00000361892	0.614	Serine/threonine-protein kinase 4
9	9606.ENSP00000452414	0.567	Protein tyrosine phosphatase, non-receptor type 21
10	9606.ENSP00000478927	0.544	Transcriptional coactivator YAP1
11	9606.ENSP00000362734	0.532	Protein crumbs homolog 2
12	9606.ENSP00000444411	0.528	FERM and PDZ domain-containing protein 1
13	9606.ENSP00000361027	0.515	Angiomotin
14	9606.ENSP00000429744	0.507	Serine/threonine-protein kinase 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0060090	1.000	molecular adaptor activity
GO:0019900	1.000	kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.992	regulation of biological process
GO:0050794	0.982	regulation of cellular process
GO:0048583	0.974	regulation of response to stimulus
GO:0060255	0.960	regulation of macromolecule metabolic process
GO:0048519	0.945	negative regulation of biological process
GO:0031323	0.923	regulation of cellular metabolic process
GO:0048523	0.921	negative regulation of cellular process
GO:0051172	0.921	negative regulation of nitrogen compound metabolic process
GO:0023051	0.916	regulation of signaling
GO:0009966	0.911	regulation of signal transduction
GO:0046620	0.910	regulation of organ growth
GO:0010605	0.910	negative regulation of macromolecule metabolic process
GO:0010468	0.904	regulation of gene expression
GO:0080090	0.903	regulation of primary metabolic process
GO:0031324	0.888	negative regulation of cellular metabolic process
GO:0009987	0.866	cellular process
GO:0019219	0.864	regulation of nucleobase-containing compound metabolic process
GO:0048585	0.851	negative regulation of response to stimulus
GO:0051252	0.848	regulation of RNA metabolic process
GO:0009968	0.818	negative regulation of signal transduction
GO:0006357	0.800	regulation of transcription by RNA polymerase II
GO:1902531	0.785	regulation of intracellular signal transduction
GO:0045892	0.773	negative regulation of DNA-templated transcription
GO:0035330	0.710	regulation of hippo signaling
GO:0035331	0.655	negative regulation of hippo signaling
GO:0046621	0.648	negative regulation of organ growth
GO:0000122	0.429	negative regulation of transcription by RNA polymerase II
GO:0048518	0.344	positive regulation of biological process
GO:0048856	0.320	anatomical structure development
GO:0048522	0.320	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.998	cytosol
GO:0016020	0.958	membrane
GO:0071944	0.934	cell periphery
GO:0005886	0.883	plasma membrane
GO:0005634	0.845	nucleus
GO:0032991	0.768	protein-containing complex
GO:0031981	0.408	nuclear lumen
GO:0012505	0.320	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]